Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4Y2J0

Protein Details
Accession C4Y2J0    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
70-93KEQDFMKWRKKQINKANTAKIKNNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 13.333, nucl 7, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG clu:CLUG_02753  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLSQALRLKLPSRLFSSTISSLDKSSVPAGTVLNLKIRKNGDEPVALEDSEYPEWLWECLDKEKQEQRLKEQDFMKWRKKQINKANTAKIKNNNFISQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.41
4 0.36
5 0.35
6 0.33
7 0.28
8 0.25
9 0.24
10 0.22
11 0.18
12 0.17
13 0.14
14 0.12
15 0.12
16 0.11
17 0.12
18 0.13
19 0.12
20 0.17
21 0.2
22 0.2
23 0.24
24 0.25
25 0.26
26 0.26
27 0.28
28 0.24
29 0.23
30 0.23
31 0.22
32 0.22
33 0.19
34 0.16
35 0.14
36 0.14
37 0.12
38 0.11
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.08
46 0.12
47 0.16
48 0.17
49 0.23
50 0.29
51 0.38
52 0.44
53 0.45
54 0.48
55 0.54
56 0.56
57 0.56
58 0.52
59 0.49
60 0.53
61 0.58
62 0.6
63 0.57
64 0.62
65 0.65
66 0.72
67 0.76
68 0.77
69 0.8
70 0.8
71 0.82
72 0.85
73 0.84
74 0.82
75 0.8
76 0.78
77 0.76
78 0.74
79 0.71