Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4Y6X4

Protein Details
Accession C4Y6X4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-30TVATPKIVKKYSKKFKRHHSDRYARVAENHydrophilic
NLS Segment(s)
PositionSequence
13-18SKKFKR
Subcellular Location(s) mito 12.5mito_nucl 12.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG clu:CLUG_03908  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MTVATPKIVKKYSKKFKRHHSDRYARVAENWRKQKGIDSCVRRRFRGTIPQPNIGYGSNKKTKFMNPSGYRVFVVKNVQDLDVLLMHTKTYAAEIAHNVSSKNRVEIVAKAKSLGVKVTNPKGRVSLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.87
4 0.91
5 0.91
6 0.9
7 0.9
8 0.9
9 0.87
10 0.88
11 0.81
12 0.7
13 0.66
14 0.65
15 0.63
16 0.63
17 0.64
18 0.57
19 0.53
20 0.52
21 0.55
22 0.51
23 0.5
24 0.48
25 0.49
26 0.56
27 0.65
28 0.68
29 0.61
30 0.58
31 0.55
32 0.52
33 0.54
34 0.54
35 0.55
36 0.55
37 0.6
38 0.57
39 0.53
40 0.48
41 0.38
42 0.33
43 0.25
44 0.27
45 0.28
46 0.28
47 0.29
48 0.29
49 0.33
50 0.36
51 0.38
52 0.41
53 0.37
54 0.43
55 0.43
56 0.43
57 0.39
58 0.32
59 0.28
60 0.21
61 0.21
62 0.16
63 0.17
64 0.16
65 0.16
66 0.15
67 0.15
68 0.13
69 0.1
70 0.1
71 0.08
72 0.07
73 0.06
74 0.06
75 0.06
76 0.05
77 0.06
78 0.07
79 0.07
80 0.09
81 0.1
82 0.13
83 0.15
84 0.16
85 0.15
86 0.15
87 0.2
88 0.19
89 0.2
90 0.18
91 0.18
92 0.2
93 0.25
94 0.31
95 0.32
96 0.31
97 0.29
98 0.29
99 0.3
100 0.29
101 0.27
102 0.23
103 0.25
104 0.33
105 0.42
106 0.48
107 0.47
108 0.48
109 0.48