Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4Y5H7

Protein Details
Accession C4Y5H7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
174-218EEQEQKVTEKKDKKHKKDKRDKKEKKDKKDKKDKKEKKHKKDKKDBasic
NLS Segment(s)
PositionSequence
183-218KKDKKHKKDKRDKKEKKDKKDKKDKKEKKHKKDKKD
Subcellular Location(s) nucl 21.5, mito_nucl 14, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013239  RNA_polI_Rpa14  
KEGG clu:CLUG_03411  -  
Pfam View protein in Pfam  
PF08203  RNA_polI_A14  
Amino Acid Sequences MSAYRPKRQMQSAVNAPVVMHVKGVKAIEKARAEALLTKFISTSEAISSAIVGSEDPILFTNTGMASGEGSNPVLGQLKRVQRDLRGLPPLSSELDTKKEEPVRKKIKFDDEGNEEGDAKEEAQDEEMEEEEEEEEKEDEEEEEEQKEEADEDEEDEIKEQEEDEEKEQTDDEEEQEQKVTEKKDKKHKKDKRDKKEKKDKKDKKDKKEKKHKKDKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.52
3 0.45
4 0.41
5 0.36
6 0.27
7 0.2
8 0.15
9 0.15
10 0.18
11 0.19
12 0.18
13 0.2
14 0.23
15 0.29
16 0.3
17 0.31
18 0.29
19 0.29
20 0.26
21 0.29
22 0.28
23 0.27
24 0.26
25 0.24
26 0.23
27 0.22
28 0.23
29 0.17
30 0.16
31 0.1
32 0.1
33 0.1
34 0.1
35 0.1
36 0.08
37 0.08
38 0.06
39 0.05
40 0.05
41 0.06
42 0.06
43 0.07
44 0.07
45 0.09
46 0.09
47 0.09
48 0.09
49 0.08
50 0.08
51 0.08
52 0.07
53 0.07
54 0.07
55 0.08
56 0.07
57 0.07
58 0.07
59 0.06
60 0.07
61 0.1
62 0.1
63 0.12
64 0.18
65 0.24
66 0.26
67 0.3
68 0.31
69 0.29
70 0.36
71 0.37
72 0.36
73 0.37
74 0.35
75 0.32
76 0.31
77 0.3
78 0.25
79 0.22
80 0.17
81 0.13
82 0.17
83 0.18
84 0.18
85 0.21
86 0.25
87 0.29
88 0.34
89 0.42
90 0.49
91 0.5
92 0.54
93 0.54
94 0.57
95 0.56
96 0.53
97 0.49
98 0.43
99 0.41
100 0.38
101 0.33
102 0.25
103 0.2
104 0.18
105 0.12
106 0.07
107 0.07
108 0.07
109 0.06
110 0.07
111 0.07
112 0.06
113 0.07
114 0.07
115 0.06
116 0.06
117 0.06
118 0.05
119 0.06
120 0.05
121 0.06
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.07
128 0.08
129 0.08
130 0.09
131 0.09
132 0.09
133 0.08
134 0.08
135 0.08
136 0.07
137 0.07
138 0.06
139 0.07
140 0.08
141 0.09
142 0.09
143 0.09
144 0.09
145 0.08
146 0.08
147 0.07
148 0.08
149 0.11
150 0.13
151 0.15
152 0.17
153 0.17
154 0.18
155 0.18
156 0.16
157 0.15
158 0.14
159 0.14
160 0.16
161 0.17
162 0.17
163 0.18
164 0.18
165 0.17
166 0.21
167 0.24
168 0.28
169 0.36
170 0.43
171 0.54
172 0.65
173 0.74
174 0.81
175 0.86
176 0.88
177 0.91
178 0.94
179 0.95
180 0.95
181 0.95
182 0.95
183 0.97
184 0.96
185 0.96
186 0.96
187 0.95
188 0.95
189 0.96
190 0.95
191 0.95
192 0.96
193 0.95
194 0.95
195 0.96
196 0.96
197 0.96
198 0.97