Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4XZY7

Protein Details
Accession C4XZY7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-37RQGGKAKPLKAPKKKNQEYDEBasic
NLS Segment(s)
PositionSequence
19-31GGKAKPLKAPKKK
44-77AKQKADAAAKKAMAEKAKKGGPLIGGGIKKSGKK
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
KEGG clu:CLUG_01519  -  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MRENCSPFNYYLQMSGRQGGKAKPLKAPKKKNQEYDEDDEAFKAKQKADAAAKKAMAEKAKKGGPLIGGGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.29
4 0.28
5 0.3
6 0.27
7 0.33
8 0.35
9 0.36
10 0.39
11 0.47
12 0.55
13 0.63
14 0.72
15 0.72
16 0.77
17 0.82
18 0.84
19 0.78
20 0.76
21 0.72
22 0.68
23 0.62
24 0.52
25 0.45
26 0.36
27 0.32
28 0.24
29 0.2
30 0.16
31 0.12
32 0.14
33 0.15
34 0.2
35 0.28
36 0.34
37 0.35
38 0.37
39 0.38
40 0.35
41 0.37
42 0.36
43 0.34
44 0.32
45 0.32
46 0.35
47 0.37
48 0.37
49 0.35
50 0.33
51 0.28
52 0.27
53 0.26
54 0.25
55 0.24
56 0.24
57 0.27