Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4Y3I9

Protein Details
Accession C4Y3I9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-42YLWKKAPRLSPPQKQRLRNRMKLVDRNIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG clu:CLUG_03102  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGVFRGTLARCGGYLWKKAPRLSPPQKQRLRNRMKLVDRNIEILYQSLKPANAKSTGFKKIDYLKFELPKEAQMSPRDKYTTFDKKSKGYRKSVHLIPKWTKKSFRENPKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.33
4 0.4
5 0.44
6 0.47
7 0.52
8 0.52
9 0.58
10 0.62
11 0.67
12 0.69
13 0.75
14 0.8
15 0.83
16 0.86
17 0.86
18 0.86
19 0.84
20 0.83
21 0.82
22 0.82
23 0.81
24 0.76
25 0.73
26 0.64
27 0.58
28 0.5
29 0.41
30 0.32
31 0.24
32 0.2
33 0.12
34 0.12
35 0.1
36 0.1
37 0.11
38 0.12
39 0.13
40 0.14
41 0.15
42 0.18
43 0.22
44 0.28
45 0.27
46 0.26
47 0.28
48 0.33
49 0.37
50 0.37
51 0.37
52 0.36
53 0.4
54 0.4
55 0.39
56 0.32
57 0.3
58 0.29
59 0.26
60 0.26
61 0.27
62 0.3
63 0.28
64 0.32
65 0.31
66 0.29
67 0.3
68 0.35
69 0.4
70 0.42
71 0.47
72 0.47
73 0.52
74 0.62
75 0.69
76 0.67
77 0.66
78 0.67
79 0.68
80 0.72
81 0.73
82 0.72
83 0.69
84 0.7
85 0.7
86 0.74
87 0.74
88 0.73
89 0.74
90 0.7
91 0.75
92 0.76
93 0.78