Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4Y7L5

Protein Details
Accession C4Y7L5   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-41IQNGHGRRKPSVQRRARKRTSSPIQSGRHydrophilic
NLS Segment(s)
PositionSequence
18-44HGRRKPSVQRRARKRTSSPIQSGRARA
Subcellular Location(s) cyto 10.5, mito 9, cyto_nucl 9, nucl 6.5
Family & Domain DBs
KEGG clu:CLUG_04193  -  
Amino Acid Sequences MGESFGADWRSRAIQNGHGRRKPSVQRRARKRTSSPIQSGRARAVLPRRVGARPVCAVHIPVRAGYAPVPCDARGARVSGGIRVHGAGGRGARRLARVQCSARRPPRPQPEEIHRRVYAVAWRGLRQYGDRAAPAHRGPYSDGVAFDAALLRLALP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.41
3 0.51
4 0.59
5 0.59
6 0.62
7 0.6
8 0.66
9 0.67
10 0.67
11 0.67
12 0.68
13 0.74
14 0.82
15 0.89
16 0.89
17 0.88
18 0.84
19 0.84
20 0.84
21 0.83
22 0.81
23 0.78
24 0.76
25 0.72
26 0.67
27 0.58
28 0.5
29 0.41
30 0.37
31 0.36
32 0.35
33 0.33
34 0.33
35 0.34
36 0.33
37 0.37
38 0.35
39 0.31
40 0.28
41 0.27
42 0.25
43 0.23
44 0.23
45 0.21
46 0.22
47 0.18
48 0.15
49 0.15
50 0.13
51 0.13
52 0.13
53 0.12
54 0.1
55 0.11
56 0.12
57 0.11
58 0.12
59 0.12
60 0.13
61 0.12
62 0.13
63 0.12
64 0.13
65 0.13
66 0.14
67 0.15
68 0.12
69 0.11
70 0.1
71 0.1
72 0.08
73 0.09
74 0.07
75 0.09
76 0.1
77 0.11
78 0.11
79 0.12
80 0.13
81 0.18
82 0.2
83 0.23
84 0.28
85 0.33
86 0.39
87 0.45
88 0.53
89 0.56
90 0.62
91 0.63
92 0.67
93 0.73
94 0.71
95 0.69
96 0.67
97 0.69
98 0.7
99 0.69
100 0.66
101 0.55
102 0.51
103 0.46
104 0.41
105 0.36
106 0.3
107 0.31
108 0.26
109 0.28
110 0.28
111 0.29
112 0.29
113 0.25
114 0.26
115 0.25
116 0.25
117 0.26
118 0.25
119 0.26
120 0.31
121 0.3
122 0.3
123 0.26
124 0.25
125 0.27
126 0.3
127 0.31
128 0.27
129 0.26
130 0.23
131 0.22
132 0.2
133 0.17
134 0.14
135 0.11
136 0.1