Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q0V5Z3

Protein Details
Accession Q0V5Z3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-30GAIKTKSKPVVPKKKQQTRPGARVVKPHydrophilic
NLS Segment(s)
PositionSequence
8-35TKSKPVVPKKKQQTRPGARVVKPKKASL
67-81LKGGKKDKKEAKKTK
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 9, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG pno:SNOG_00571  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGAIKTKSKPVVPKKKQQTRPGARVVKPKKASLIQQNKIKHKSSSGLIGQTEKLMAEKAGHLELLKGGKKDKKEAKKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.73
3 0.79
4 0.84
5 0.88
6 0.87
7 0.88
8 0.86
9 0.85
10 0.85
11 0.82
12 0.76
13 0.77
14 0.74
15 0.72
16 0.65
17 0.59
18 0.54
19 0.49
20 0.5
21 0.5
22 0.54
23 0.52
24 0.56
25 0.61
26 0.63
27 0.64
28 0.6
29 0.5
30 0.42
31 0.38
32 0.32
33 0.32
34 0.27
35 0.25
36 0.24
37 0.24
38 0.22
39 0.19
40 0.18
41 0.12
42 0.1
43 0.08
44 0.07
45 0.07
46 0.08
47 0.1
48 0.1
49 0.1
50 0.1
51 0.1
52 0.13
53 0.18
54 0.2
55 0.2
56 0.26
57 0.3
58 0.35
59 0.44
60 0.52
61 0.57