Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4XYB0

Protein Details
Accession C4XYB0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
357-381ESYKRRPPSIFLPKRKMPRAPRISVHydrophilic
NLS Segment(s)
PositionSequence
360-390KRRPPSIFLPKRKMPRAPRISVPKGEKETKT
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010684  RNA_pol_II_trans_fac_SIII_A  
Gene Ontology GO:0070449  C:elongin complex  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG clu:CLUG_00933  -  
Pfam View protein in Pfam  
PF06881  Elongin_A  
Amino Acid Sequences MVRSLFDTALAACVQNASLIDNVGTTPYHLVRPILKRLSAKQLAQLEENSPSVTPESDELWRVLIEKDFPDRPLPRRQYVSGGDMPTKATYFQYVAERDELRASSAQRLRKFTERIQREKSRNQIVPLKGILHEPVRRKVPSTFTPFSTNARPKSILGKAMRDMQHRSLIFQGARKYDPYRAFKQRDQQTDNGQYRDRRAERTMVGKTEENEARGRKENPNSTGNMSRKKRKVDNQVPSSAPFLYFAVSSRTRSSDNGRFLAGPETTSFEEASRNAGQDITDSGTASAESERASSSTISEAAPSLTETPTTSSIQSVRKSNSTPPAASLSPSPKPASPSSSSNLPSSTEQVRREAPESYKRRPPSIFLPKRKMPRAPRISVPKGEKETKTREPQAKETKDSQGNEDVPVKRALRSSIFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.09
5 0.09
6 0.1
7 0.1
8 0.09
9 0.1
10 0.1
11 0.09
12 0.09
13 0.12
14 0.13
15 0.15
16 0.17
17 0.19
18 0.26
19 0.33
20 0.41
21 0.43
22 0.46
23 0.49
24 0.53
25 0.61
26 0.6
27 0.55
28 0.53
29 0.54
30 0.51
31 0.49
32 0.46
33 0.38
34 0.34
35 0.33
36 0.26
37 0.19
38 0.18
39 0.16
40 0.14
41 0.13
42 0.12
43 0.14
44 0.15
45 0.17
46 0.16
47 0.16
48 0.16
49 0.16
50 0.16
51 0.15
52 0.16
53 0.17
54 0.22
55 0.23
56 0.25
57 0.32
58 0.36
59 0.39
60 0.47
61 0.52
62 0.52
63 0.56
64 0.56
65 0.55
66 0.53
67 0.55
68 0.5
69 0.46
70 0.41
71 0.36
72 0.35
73 0.29
74 0.26
75 0.2
76 0.15
77 0.14
78 0.13
79 0.16
80 0.2
81 0.21
82 0.23
83 0.26
84 0.26
85 0.25
86 0.26
87 0.23
88 0.2
89 0.21
90 0.2
91 0.25
92 0.29
93 0.35
94 0.38
95 0.42
96 0.44
97 0.49
98 0.53
99 0.52
100 0.57
101 0.59
102 0.62
103 0.67
104 0.72
105 0.71
106 0.74
107 0.75
108 0.73
109 0.68
110 0.65
111 0.64
112 0.57
113 0.53
114 0.47
115 0.4
116 0.32
117 0.29
118 0.26
119 0.24
120 0.27
121 0.28
122 0.32
123 0.35
124 0.35
125 0.37
126 0.38
127 0.4
128 0.42
129 0.46
130 0.43
131 0.4
132 0.45
133 0.44
134 0.44
135 0.46
136 0.45
137 0.39
138 0.4
139 0.39
140 0.34
141 0.4
142 0.39
143 0.38
144 0.33
145 0.34
146 0.32
147 0.38
148 0.41
149 0.37
150 0.38
151 0.34
152 0.38
153 0.34
154 0.33
155 0.28
156 0.28
157 0.26
158 0.26
159 0.26
160 0.22
161 0.23
162 0.25
163 0.25
164 0.28
165 0.35
166 0.37
167 0.41
168 0.48
169 0.53
170 0.54
171 0.61
172 0.62
173 0.62
174 0.61
175 0.57
176 0.55
177 0.59
178 0.58
179 0.51
180 0.47
181 0.4
182 0.39
183 0.44
184 0.38
185 0.32
186 0.31
187 0.33
188 0.32
189 0.37
190 0.36
191 0.29
192 0.29
193 0.27
194 0.25
195 0.27
196 0.26
197 0.21
198 0.22
199 0.22
200 0.22
201 0.25
202 0.28
203 0.28
204 0.33
205 0.37
206 0.38
207 0.4
208 0.39
209 0.38
210 0.43
211 0.41
212 0.44
213 0.44
214 0.49
215 0.51
216 0.56
217 0.6
218 0.61
219 0.68
220 0.69
221 0.74
222 0.71
223 0.71
224 0.65
225 0.58
226 0.51
227 0.4
228 0.3
229 0.2
230 0.15
231 0.1
232 0.09
233 0.08
234 0.12
235 0.13
236 0.15
237 0.16
238 0.18
239 0.19
240 0.21
241 0.28
242 0.3
243 0.33
244 0.32
245 0.32
246 0.3
247 0.29
248 0.3
249 0.23
250 0.16
251 0.12
252 0.14
253 0.14
254 0.14
255 0.14
256 0.11
257 0.12
258 0.12
259 0.16
260 0.14
261 0.14
262 0.13
263 0.13
264 0.13
265 0.12
266 0.13
267 0.1
268 0.1
269 0.09
270 0.09
271 0.09
272 0.09
273 0.09
274 0.08
275 0.06
276 0.06
277 0.06
278 0.07
279 0.07
280 0.08
281 0.08
282 0.08
283 0.09
284 0.1
285 0.1
286 0.1
287 0.1
288 0.09
289 0.09
290 0.09
291 0.09
292 0.08
293 0.09
294 0.09
295 0.11
296 0.14
297 0.15
298 0.15
299 0.15
300 0.2
301 0.26
302 0.29
303 0.32
304 0.33
305 0.35
306 0.38
307 0.42
308 0.46
309 0.45
310 0.42
311 0.38
312 0.4
313 0.36
314 0.35
315 0.34
316 0.31
317 0.29
318 0.32
319 0.31
320 0.28
321 0.32
322 0.34
323 0.36
324 0.34
325 0.35
326 0.36
327 0.41
328 0.41
329 0.38
330 0.36
331 0.32
332 0.3
333 0.29
334 0.33
335 0.32
336 0.32
337 0.35
338 0.38
339 0.39
340 0.39
341 0.4
342 0.4
343 0.44
344 0.49
345 0.52
346 0.57
347 0.57
348 0.62
349 0.58
350 0.57
351 0.57
352 0.62
353 0.65
354 0.66
355 0.72
356 0.73
357 0.81
358 0.83
359 0.82
360 0.8
361 0.81
362 0.8
363 0.77
364 0.79
365 0.79
366 0.79
367 0.78
368 0.75
369 0.72
370 0.7
371 0.73
372 0.69
373 0.67
374 0.68
375 0.69
376 0.72
377 0.73
378 0.73
379 0.72
380 0.77
381 0.8
382 0.78
383 0.75
384 0.71
385 0.71
386 0.7
387 0.66
388 0.6
389 0.58
390 0.52
391 0.5
392 0.52
393 0.45
394 0.4
395 0.44
396 0.41
397 0.35
398 0.37
399 0.37