Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4Y637

Protein Details
Accession C4Y637    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
145-168VSAGEKKARGHKKKGLMEKVKGLFBasic
NLS Segment(s)
PositionSequence
150-161KKARGHKKKGLM
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
KEGG clu:CLUG_03621  -  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MVSTGRGGAGNIVSAESVGHDNVPQSEGKQESKKVLYSTGRGGAGNFKTSDEIPSPKLVPQGSNTPALTTSKFTTGRGGYGNMVSNDDPELSRKLQDVDGTKEEKLQSVTSNRSFSVGRGGFGNVISNTSKGSSNESGNNLYTVVSAGEKKARGHKKKGLMEKVKGLFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.08
5 0.08
6 0.08
7 0.08
8 0.09
9 0.11
10 0.12
11 0.11
12 0.11
13 0.16
14 0.19
15 0.24
16 0.28
17 0.3
18 0.35
19 0.37
20 0.4
21 0.36
22 0.39
23 0.38
24 0.35
25 0.36
26 0.35
27 0.33
28 0.3
29 0.29
30 0.29
31 0.26
32 0.26
33 0.22
34 0.18
35 0.19
36 0.19
37 0.21
38 0.17
39 0.19
40 0.18
41 0.2
42 0.2
43 0.2
44 0.23
45 0.21
46 0.19
47 0.19
48 0.24
49 0.24
50 0.26
51 0.25
52 0.22
53 0.22
54 0.22
55 0.2
56 0.16
57 0.15
58 0.17
59 0.18
60 0.17
61 0.21
62 0.19
63 0.2
64 0.19
65 0.19
66 0.14
67 0.14
68 0.16
69 0.12
70 0.13
71 0.12
72 0.11
73 0.1
74 0.1
75 0.08
76 0.08
77 0.11
78 0.1
79 0.11
80 0.11
81 0.12
82 0.13
83 0.16
84 0.18
85 0.2
86 0.23
87 0.25
88 0.24
89 0.25
90 0.24
91 0.22
92 0.21
93 0.17
94 0.17
95 0.2
96 0.25
97 0.26
98 0.28
99 0.26
100 0.27
101 0.26
102 0.22
103 0.27
104 0.22
105 0.19
106 0.19
107 0.19
108 0.18
109 0.18
110 0.2
111 0.11
112 0.13
113 0.13
114 0.12
115 0.12
116 0.13
117 0.15
118 0.13
119 0.19
120 0.2
121 0.23
122 0.27
123 0.29
124 0.31
125 0.29
126 0.29
127 0.23
128 0.19
129 0.16
130 0.12
131 0.1
132 0.09
133 0.1
134 0.12
135 0.16
136 0.19
137 0.22
138 0.32
139 0.42
140 0.49
141 0.57
142 0.63
143 0.69
144 0.76
145 0.83
146 0.84
147 0.83
148 0.8
149 0.8