Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4Y3Z3

Protein Details
Accession C4Y3Z3   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
99-119ATTKIKAAPRSRKKPDPAGYRHydrophilic
NLS Segment(s)
PositionSequence
104-112KAAPRSRKK
Subcellular Location(s) plas 7, extr 6, cyto 5.5, mito 5, cyto_nucl 4, nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
IPR018506  Cyt_B5_heme-BS  
Gene Ontology GO:0016020  C:membrane  
GO:0020037  F:heme binding  
GO:0046872  F:metal ion binding  
KEGG clu:CLUG_02365  -  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PROSITE View protein in PROSITE  
PS00191  CYTOCHROME_B5_1  
PS50255  CYTOCHROME_B5_2  
Amino Acid Sequences MASTSKSPSIYSLSQVSKHATPTDLWVIIYNNVYDISDFVKDHPGGAEVLFDCGGVDATEAFEDVGHSQDAVDMLVPYYVGKLAPNECKVYRQQEEKIATTKIKAAPRSRKKPDPAGYRALAVVWMTLISMTVLVVLGLQKMHWINITSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.36
4 0.32
5 0.33
6 0.31
7 0.25
8 0.22
9 0.25
10 0.28
11 0.24
12 0.22
13 0.21
14 0.21
15 0.21
16 0.22
17 0.16
18 0.12
19 0.12
20 0.11
21 0.1
22 0.09
23 0.09
24 0.1
25 0.1
26 0.11
27 0.17
28 0.16
29 0.17
30 0.16
31 0.15
32 0.14
33 0.13
34 0.14
35 0.08
36 0.09
37 0.09
38 0.08
39 0.07
40 0.06
41 0.07
42 0.05
43 0.05
44 0.03
45 0.04
46 0.04
47 0.04
48 0.04
49 0.03
50 0.04
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.03
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.06
70 0.09
71 0.14
72 0.16
73 0.19
74 0.19
75 0.22
76 0.26
77 0.31
78 0.32
79 0.33
80 0.34
81 0.39
82 0.42
83 0.41
84 0.41
85 0.37
86 0.33
87 0.28
88 0.3
89 0.28
90 0.3
91 0.34
92 0.4
93 0.49
94 0.59
95 0.69
96 0.72
97 0.75
98 0.77
99 0.8
100 0.81
101 0.79
102 0.74
103 0.7
104 0.63
105 0.55
106 0.49
107 0.38
108 0.3
109 0.2
110 0.15
111 0.08
112 0.06
113 0.05
114 0.05
115 0.05
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.05
125 0.05
126 0.06
127 0.1
128 0.1
129 0.12
130 0.14