Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UX64

Protein Details
Accession Q0UX64   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
12-40IEICRRKDAKSARIKKNKKVNNIKFKVRCHydrophilic
NLS Segment(s)
PositionSequence
17-31RKDAKSARIKKNKKV
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0022618  P:ribonucleoprotein complex assembly  
GO:0006412  P:translation  
KEGG pno:SNOG_03650  -  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVSDIKQFIEICRRKDAKSARIKKNKKVNNIKFKVRCSKNVYTLVLKDTDKAEKLKQSLPPGLTISDVGKKNPKGKHAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.43
3 0.45
4 0.42
5 0.5
6 0.55
7 0.54
8 0.6
9 0.67
10 0.68
11 0.76
12 0.82
13 0.82
14 0.84
15 0.82
16 0.81
17 0.82
18 0.82
19 0.82
20 0.81
21 0.82
22 0.77
23 0.76
24 0.75
25 0.67
26 0.65
27 0.61
28 0.6
29 0.57
30 0.57
31 0.53
32 0.45
33 0.43
34 0.37
35 0.32
36 0.27
37 0.22
38 0.19
39 0.19
40 0.19
41 0.2
42 0.22
43 0.24
44 0.27
45 0.31
46 0.34
47 0.37
48 0.41
49 0.39
50 0.39
51 0.35
52 0.32
53 0.28
54 0.24
55 0.21
56 0.23
57 0.23
58 0.24
59 0.31
60 0.36
61 0.43
62 0.47