Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4XZE4

Protein Details
Accession C4XZE4   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
56-75DINFFKKSPRRNSNHSQNEAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
KEGG clu:CLUG_01326  -  
Amino Acid Sequences MARTQKWTVHEGASEPRYFTHNGHIDTNPNKVSKEGNGKFNWGKPGDELEDEELGDINFFKKSPRRNSNHSQNEAQIQRAIEEKDAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.26
4 0.26
5 0.27
6 0.25
7 0.27
8 0.28
9 0.3
10 0.33
11 0.33
12 0.36
13 0.36
14 0.4
15 0.33
16 0.28
17 0.26
18 0.23
19 0.24
20 0.23
21 0.32
22 0.31
23 0.35
24 0.34
25 0.39
26 0.39
27 0.4
28 0.4
29 0.3
30 0.27
31 0.21
32 0.23
33 0.2
34 0.19
35 0.18
36 0.14
37 0.14
38 0.13
39 0.12
40 0.09
41 0.07
42 0.07
43 0.06
44 0.05
45 0.05
46 0.05
47 0.09
48 0.15
49 0.24
50 0.35
51 0.45
52 0.51
53 0.59
54 0.69
55 0.77
56 0.81
57 0.78
58 0.71
59 0.64
60 0.66
61 0.6
62 0.52
63 0.44
64 0.34
65 0.29
66 0.3
67 0.28