Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4YA03

Protein Details
Accession C4YA03   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
177-208TQTATRAWTPKRRRSCPTRPPRYIRLPTRTCPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 8, nucl 3, extr 3, golg 2
Family & Domain DBs
KEGG clu:CLUG_04941  -  
Amino Acid Sequences MACDQAIFLQCGRSRRSAQYACACRMSYQEGGARSHLNGRDLSFFCGHCCVFWCSVVFFWCSVLICSDLYCSDSCCSVLCCSDRCCSDRVVSFCSDRFSVSICVLSSCPNPASASAWKRKSSPSPSRTSRRCSTSPTTKPKDPTKCRPTTAWISPPEPSSIPISTTIASTSPLSSPTQTATRAWTPKRRRSCPTRPPRYIRLPTRTCPAACF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.52
4 0.5
5 0.55
6 0.6
7 0.63
8 0.6
9 0.6
10 0.54
11 0.45
12 0.43
13 0.4
14 0.32
15 0.28
16 0.28
17 0.27
18 0.28
19 0.29
20 0.28
21 0.23
22 0.28
23 0.27
24 0.25
25 0.24
26 0.23
27 0.28
28 0.28
29 0.31
30 0.27
31 0.25
32 0.24
33 0.26
34 0.24
35 0.17
36 0.2
37 0.19
38 0.18
39 0.19
40 0.19
41 0.16
42 0.18
43 0.19
44 0.16
45 0.13
46 0.12
47 0.12
48 0.11
49 0.11
50 0.1
51 0.1
52 0.09
53 0.09
54 0.09
55 0.08
56 0.09
57 0.09
58 0.1
59 0.09
60 0.1
61 0.1
62 0.09
63 0.11
64 0.1
65 0.13
66 0.13
67 0.15
68 0.17
69 0.2
70 0.22
71 0.22
72 0.23
73 0.22
74 0.23
75 0.25
76 0.25
77 0.25
78 0.25
79 0.25
80 0.24
81 0.24
82 0.21
83 0.17
84 0.15
85 0.13
86 0.13
87 0.12
88 0.12
89 0.1
90 0.1
91 0.1
92 0.12
93 0.1
94 0.1
95 0.1
96 0.09
97 0.09
98 0.09
99 0.12
100 0.16
101 0.22
102 0.28
103 0.32
104 0.33
105 0.34
106 0.38
107 0.42
108 0.46
109 0.5
110 0.49
111 0.54
112 0.6
113 0.68
114 0.7
115 0.69
116 0.65
117 0.62
118 0.57
119 0.56
120 0.56
121 0.57
122 0.62
123 0.65
124 0.66
125 0.64
126 0.69
127 0.71
128 0.74
129 0.72
130 0.73
131 0.73
132 0.73
133 0.71
134 0.67
135 0.64
136 0.61
137 0.59
138 0.56
139 0.5
140 0.46
141 0.44
142 0.43
143 0.38
144 0.31
145 0.26
146 0.23
147 0.19
148 0.18
149 0.18
150 0.18
151 0.16
152 0.16
153 0.15
154 0.11
155 0.13
156 0.12
157 0.11
158 0.11
159 0.12
160 0.14
161 0.14
162 0.15
163 0.16
164 0.19
165 0.2
166 0.2
167 0.24
168 0.3
169 0.37
170 0.43
171 0.51
172 0.57
173 0.65
174 0.75
175 0.77
176 0.79
177 0.81
178 0.85
179 0.86
180 0.87
181 0.89
182 0.88
183 0.88
184 0.88
185 0.89
186 0.88
187 0.86
188 0.86
189 0.82
190 0.76
191 0.76
192 0.73