Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4XW95

Protein Details
Accession C4XW95   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23METRKRLAKQSRTRESPEKKSSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR020471  AKR  
IPR018170  Aldo/ket_reductase_CS  
IPR023210  NADP_OxRdtase_dom  
IPR036812  NADP_OxRdtase_dom_sf  
Gene Ontology GO:0016616  F:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor  
KEGG clu:CLUG_00218  -  
Pfam View protein in Pfam  
PF00248  Aldo_ket_red  
PROSITE View protein in PROSITE  
PS00062  ALDOKETO_REDUCTASE_2  
CDD cd19071  AKR_AKR1-5-like  
Amino Acid Sequences METRKRLAKQSRTRESPEKKSSSHPSCGTMTTRIQVQPLKNLLKDLGLEYLDLYLMHWPVSNSDGRKSEEKDYDYIETYKKMQELAKSGKAKAIGISNFTKERIEKLLSDPEVTIKPAALQIEAHPLLTQPELFNYAKKENILIEAYSPLGHSSGDSPLFKNSLITSVAEKYGVDPAQVLISWAVQRGTVVLPKSVHEERIISNLKTFTLADEDFEALNNLSKKEGSQRVNDTPWDVFSNDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.83
4 0.82
5 0.77
6 0.69
7 0.71
8 0.74
9 0.7
10 0.69
11 0.61
12 0.56
13 0.52
14 0.53
15 0.48
16 0.42
17 0.37
18 0.31
19 0.33
20 0.3
21 0.32
22 0.34
23 0.33
24 0.36
25 0.41
26 0.43
27 0.39
28 0.4
29 0.36
30 0.32
31 0.3
32 0.24
33 0.19
34 0.15
35 0.14
36 0.13
37 0.12
38 0.11
39 0.09
40 0.08
41 0.07
42 0.07
43 0.08
44 0.08
45 0.08
46 0.09
47 0.12
48 0.16
49 0.16
50 0.2
51 0.24
52 0.26
53 0.31
54 0.34
55 0.38
56 0.39
57 0.4
58 0.37
59 0.36
60 0.35
61 0.33
62 0.31
63 0.26
64 0.22
65 0.21
66 0.21
67 0.19
68 0.19
69 0.19
70 0.2
71 0.26
72 0.3
73 0.37
74 0.37
75 0.37
76 0.37
77 0.35
78 0.32
79 0.27
80 0.26
81 0.18
82 0.2
83 0.21
84 0.22
85 0.22
86 0.22
87 0.22
88 0.17
89 0.18
90 0.18
91 0.18
92 0.16
93 0.19
94 0.25
95 0.24
96 0.24
97 0.22
98 0.2
99 0.19
100 0.18
101 0.15
102 0.08
103 0.08
104 0.09
105 0.09
106 0.07
107 0.07
108 0.07
109 0.13
110 0.13
111 0.12
112 0.11
113 0.11
114 0.11
115 0.11
116 0.11
117 0.05
118 0.06
119 0.11
120 0.11
121 0.13
122 0.15
123 0.16
124 0.17
125 0.17
126 0.18
127 0.13
128 0.16
129 0.15
130 0.12
131 0.11
132 0.1
133 0.11
134 0.1
135 0.09
136 0.07
137 0.06
138 0.06
139 0.05
140 0.06
141 0.09
142 0.12
143 0.13
144 0.13
145 0.14
146 0.15
147 0.15
148 0.15
149 0.12
150 0.12
151 0.12
152 0.12
153 0.13
154 0.13
155 0.14
156 0.13
157 0.13
158 0.11
159 0.15
160 0.14
161 0.12
162 0.11
163 0.11
164 0.12
165 0.11
166 0.11
167 0.06
168 0.08
169 0.08
170 0.09
171 0.09
172 0.08
173 0.08
174 0.09
175 0.1
176 0.13
177 0.13
178 0.16
179 0.16
180 0.17
181 0.24
182 0.24
183 0.24
184 0.22
185 0.23
186 0.22
187 0.3
188 0.33
189 0.27
190 0.29
191 0.28
192 0.27
193 0.27
194 0.25
195 0.18
196 0.19
197 0.18
198 0.16
199 0.17
200 0.18
201 0.16
202 0.16
203 0.16
204 0.11
205 0.16
206 0.16
207 0.15
208 0.15
209 0.16
210 0.17
211 0.25
212 0.34
213 0.33
214 0.4
215 0.47
216 0.53
217 0.57
218 0.57
219 0.51
220 0.44
221 0.43
222 0.38