Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4Y9Z5

Protein Details
Accession C4Y9Z5   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
104-126SSAKVAPKRKSRKSTSIRQRWAMHydrophilic
NLS Segment(s)
PositionSequence
110-116PKRKSRK
Subcellular Location(s) mito 15.5, mito_nucl 13, nucl 9.5
Family & Domain DBs
KEGG clu:CLUG_04843  -  
Amino Acid Sequences MFRIFIESKTIRASVRKNSLWEIQLNSRAMHCGFESDTSNLGTDAWLDDKRLFTSRGSFQNLYAYSFTQVQASMSMQSWGMVQNDLRHVGSEIGEEIHHAILISSAKVAPKRKSRKSTSIRQRWAMHLRSQRYSHTKKYYSHGLLEGVSTLHIRELVRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.47
3 0.48
4 0.48
5 0.51
6 0.54
7 0.51
8 0.48
9 0.44
10 0.4
11 0.43
12 0.41
13 0.37
14 0.31
15 0.31
16 0.27
17 0.24
18 0.18
19 0.14
20 0.14
21 0.15
22 0.18
23 0.16
24 0.17
25 0.16
26 0.16
27 0.14
28 0.13
29 0.1
30 0.08
31 0.07
32 0.09
33 0.09
34 0.1
35 0.11
36 0.12
37 0.15
38 0.17
39 0.17
40 0.15
41 0.2
42 0.24
43 0.29
44 0.34
45 0.32
46 0.3
47 0.35
48 0.34
49 0.31
50 0.27
51 0.21
52 0.17
53 0.17
54 0.17
55 0.11
56 0.11
57 0.09
58 0.09
59 0.09
60 0.08
61 0.07
62 0.08
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.09
71 0.1
72 0.11
73 0.11
74 0.1
75 0.1
76 0.1
77 0.1
78 0.08
79 0.07
80 0.07
81 0.06
82 0.06
83 0.06
84 0.06
85 0.05
86 0.05
87 0.04
88 0.05
89 0.06
90 0.06
91 0.06
92 0.07
93 0.09
94 0.14
95 0.2
96 0.25
97 0.35
98 0.46
99 0.55
100 0.64
101 0.7
102 0.76
103 0.79
104 0.82
105 0.83
106 0.84
107 0.82
108 0.8
109 0.75
110 0.73
111 0.73
112 0.66
113 0.64
114 0.61
115 0.59
116 0.58
117 0.58
118 0.57
119 0.59
120 0.61
121 0.62
122 0.64
123 0.64
124 0.62
125 0.66
126 0.68
127 0.62
128 0.59
129 0.52
130 0.44
131 0.38
132 0.34
133 0.28
134 0.18
135 0.15
136 0.12
137 0.1
138 0.08
139 0.11