Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4Y2T9

Protein Details
Accession C4Y2T9   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
116-136EPEKVEEETKKPKKKKKGKKKBasic
NLS Segment(s)
PositionSequence
125-136KKPKKKKKGKKK
Subcellular Location(s) cyto_nucl 12.833, cyto 12.5, nucl 12, mito_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR039432  SRP9_dom  
KEGG clu:CLUG_02852  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MENFISATADLFEAFPGATVSITYSNVGKKNAEPKQSAASHIAKFKVFDAHTGKCIRYKTSKSKEVSRILTYLGPRGVSGLKRQHEGEHEENKKQRVGVSSIMANSKFEEPEVTAEPEKVEEETKKPKKKKKGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.05
6 0.05
7 0.07
8 0.09
9 0.1
10 0.1
11 0.12
12 0.16
13 0.19
14 0.21
15 0.21
16 0.24
17 0.33
18 0.38
19 0.42
20 0.4
21 0.4
22 0.46
23 0.46
24 0.44
25 0.4
26 0.38
27 0.35
28 0.36
29 0.35
30 0.28
31 0.27
32 0.25
33 0.26
34 0.21
35 0.24
36 0.26
37 0.26
38 0.3
39 0.31
40 0.31
41 0.28
42 0.3
43 0.28
44 0.3
45 0.35
46 0.41
47 0.48
48 0.55
49 0.54
50 0.61
51 0.65
52 0.64
53 0.61
54 0.51
55 0.43
56 0.37
57 0.36
58 0.28
59 0.23
60 0.17
61 0.13
62 0.11
63 0.12
64 0.13
65 0.12
66 0.17
67 0.22
68 0.23
69 0.26
70 0.27
71 0.27
72 0.29
73 0.35
74 0.36
75 0.38
76 0.4
77 0.44
78 0.48
79 0.48
80 0.45
81 0.39
82 0.35
83 0.29
84 0.29
85 0.26
86 0.25
87 0.25
88 0.25
89 0.27
90 0.25
91 0.22
92 0.2
93 0.19
94 0.16
95 0.14
96 0.14
97 0.12
98 0.16
99 0.19
100 0.21
101 0.2
102 0.2
103 0.21
104 0.2
105 0.2
106 0.17
107 0.18
108 0.17
109 0.23
110 0.34
111 0.44
112 0.53
113 0.62
114 0.71
115 0.78
116 0.86