Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4XW68

Protein Details
Accession C4XW68    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
122-145NEALVRQARRSRRRRSSNMSSVSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034751  Yippee  
IPR004910  Yippee/Mis18/Cereblon  
IPR039058  Yippee_fam  
Gene Ontology GO:0046872  F:metal ion binding  
KEGG clu:CLUG_00191  -  
Pfam View protein in Pfam  
PF03226  Yippee-Mis18  
PROSITE View protein in PROSITE  
PS51792  YIPPEE  
Amino Acid Sequences MGLKSTDFFENTSYEADTHIIVCNECSTHLCLSSLVLSDKFCSQSGDAYLVDRVINVQPDGEDRKTPMKTGVYLINKIRCSQCATTLGWLYKKSFSYSELYKEGKYVIERAFIHEIPNLSSNEALVRQARRSRRRRSSNMSSVSSSSDEVLPTPSSLDPMLRRALVGKDDDHVFVDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.13
5 0.12
6 0.14
7 0.13
8 0.12
9 0.13
10 0.13
11 0.13
12 0.13
13 0.14
14 0.14
15 0.15
16 0.15
17 0.15
18 0.14
19 0.15
20 0.15
21 0.15
22 0.14
23 0.14
24 0.13
25 0.14
26 0.16
27 0.17
28 0.16
29 0.16
30 0.15
31 0.16
32 0.17
33 0.18
34 0.16
35 0.15
36 0.15
37 0.14
38 0.13
39 0.1
40 0.1
41 0.09
42 0.1
43 0.09
44 0.09
45 0.08
46 0.12
47 0.16
48 0.16
49 0.16
50 0.17
51 0.23
52 0.23
53 0.24
54 0.25
55 0.22
56 0.22
57 0.23
58 0.28
59 0.25
60 0.29
61 0.31
62 0.33
63 0.32
64 0.32
65 0.31
66 0.25
67 0.27
68 0.24
69 0.24
70 0.22
71 0.22
72 0.22
73 0.23
74 0.23
75 0.2
76 0.2
77 0.18
78 0.18
79 0.18
80 0.18
81 0.16
82 0.17
83 0.19
84 0.2
85 0.22
86 0.24
87 0.25
88 0.23
89 0.23
90 0.21
91 0.19
92 0.18
93 0.18
94 0.14
95 0.18
96 0.19
97 0.22
98 0.26
99 0.24
100 0.24
101 0.22
102 0.22
103 0.18
104 0.21
105 0.17
106 0.14
107 0.13
108 0.12
109 0.12
110 0.12
111 0.12
112 0.12
113 0.14
114 0.19
115 0.26
116 0.36
117 0.45
118 0.54
119 0.63
120 0.7
121 0.78
122 0.82
123 0.85
124 0.86
125 0.85
126 0.83
127 0.76
128 0.68
129 0.58
130 0.52
131 0.44
132 0.34
133 0.25
134 0.19
135 0.15
136 0.14
137 0.15
138 0.13
139 0.12
140 0.13
141 0.12
142 0.13
143 0.13
144 0.17
145 0.17
146 0.2
147 0.23
148 0.21
149 0.21
150 0.22
151 0.25
152 0.25
153 0.26
154 0.23
155 0.24
156 0.25
157 0.26