Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4Y3Q4

Protein Details
Accession C4Y3Q4    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-26GNLKLKSKAKGRVTKKQSNLRAAHydrophilic
NLS Segment(s)
PositionSequence
8-39LKSKAKGRVTKKQSNLRAAAPLILKPKKATAK
71-88SRRQIEKEDKASKKKSAK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG clu:CLUG_03167  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGNLKLKSKAKGRVTKKQSNLRAAAPLILKPKKATAKQAFKLKQSVGSSIGTEKLIASRVGHLELIKGSRRQIEKEDKASKKKSAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.78
4 0.8
5 0.82
6 0.82
7 0.8
8 0.78
9 0.73
10 0.64
11 0.59
12 0.49
13 0.44
14 0.35
15 0.3
16 0.3
17 0.28
18 0.27
19 0.24
20 0.3
21 0.34
22 0.35
23 0.43
24 0.44
25 0.52
26 0.57
27 0.66
28 0.63
29 0.58
30 0.59
31 0.5
32 0.46
33 0.37
34 0.33
35 0.25
36 0.23
37 0.21
38 0.18
39 0.19
40 0.13
41 0.12
42 0.1
43 0.08
44 0.09
45 0.09
46 0.09
47 0.1
48 0.11
49 0.13
50 0.14
51 0.13
52 0.12
53 0.14
54 0.17
55 0.18
56 0.19
57 0.2
58 0.26
59 0.29
60 0.32
61 0.39
62 0.46
63 0.5
64 0.58
65 0.66
66 0.68
67 0.75
68 0.77