Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4XZ85

Protein Details
Accession C4XZ85   
Localization Confidence High
Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-27AGMHDKRKPFQGKKFHKDLREFKNQEBasic
123-168AKLAKERKEREREEKLRRVRERRQALEQKNKERERKKESLSKRTKTBasic
NLS Segment(s)
PositionSequence
13-16GKKF
98-167PPQRAPPARAQPKPQPRKVINFAERAKLAKERKEREREEKLRRVRERRQALEQKNKERERKKESLSKRTK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
KEGG clu:CLUG_01267  -  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MAGMHDKRKPFQGKKFHKDLREFKNQEIKRSLVHRARLRKNYFKLLESEGQTTPESQKEKQSDEDNEENDDSGSESESEKEELPETSVSKIKSSGPLPPQRAPPARAQPKPQPRKVINFAERAKLAKERKEREREEKLRRVRERRQALEQKNKERERKKESLSKRTKTGQPVMGPKINDLLDKIRQNIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.86
3 0.84
4 0.83
5 0.83
6 0.83
7 0.81
8 0.81
9 0.75
10 0.71
11 0.74
12 0.68
13 0.65
14 0.61
15 0.54
16 0.48
17 0.49
18 0.52
19 0.48
20 0.54
21 0.55
22 0.6
23 0.69
24 0.73
25 0.77
26 0.77
27 0.76
28 0.77
29 0.72
30 0.64
31 0.58
32 0.53
33 0.51
34 0.43
35 0.41
36 0.31
37 0.3
38 0.28
39 0.26
40 0.23
41 0.23
42 0.23
43 0.21
44 0.28
45 0.3
46 0.32
47 0.35
48 0.39
49 0.37
50 0.4
51 0.43
52 0.37
53 0.35
54 0.33
55 0.28
56 0.22
57 0.19
58 0.13
59 0.08
60 0.08
61 0.06
62 0.06
63 0.07
64 0.08
65 0.09
66 0.09
67 0.09
68 0.09
69 0.09
70 0.1
71 0.11
72 0.1
73 0.11
74 0.14
75 0.14
76 0.13
77 0.14
78 0.14
79 0.17
80 0.17
81 0.21
82 0.25
83 0.32
84 0.36
85 0.38
86 0.41
87 0.43
88 0.45
89 0.42
90 0.42
91 0.45
92 0.49
93 0.5
94 0.52
95 0.55
96 0.62
97 0.69
98 0.67
99 0.66
100 0.61
101 0.66
102 0.67
103 0.67
104 0.62
105 0.61
106 0.57
107 0.52
108 0.5
109 0.43
110 0.38
111 0.36
112 0.35
113 0.35
114 0.43
115 0.46
116 0.55
117 0.63
118 0.68
119 0.69
120 0.76
121 0.77
122 0.78
123 0.8
124 0.8
125 0.81
126 0.83
127 0.83
128 0.81
129 0.82
130 0.82
131 0.78
132 0.8
133 0.79
134 0.8
135 0.82
136 0.82
137 0.82
138 0.82
139 0.84
140 0.83
141 0.82
142 0.82
143 0.8
144 0.79
145 0.77
146 0.77
147 0.79
148 0.81
149 0.83
150 0.79
151 0.77
152 0.76
153 0.75
154 0.74
155 0.72
156 0.68
157 0.65
158 0.68
159 0.67
160 0.64
161 0.58
162 0.5
163 0.48
164 0.41
165 0.35
166 0.29
167 0.28
168 0.31
169 0.35