Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4XYP2

Protein Details
Accession C4XYP2   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
141-166TTTTLSKKRAKKIERNKRYVAKRNEQHydrophilic
NLS Segment(s)
PositionSequence
147-158KKRAKKIERNKR
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
KEGG clu:CLUG_01065  -  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MRYEILSVAKSAKARDCNGIVILRSGVRLTPGRFFFANPPVSSSPSSPCTHTTERYFSTCRHHIDKQEMPSRNSVNKPKGKLQAAHRSNVISKKKAYRANRVVPTRSSNGRYNTDTAPRPTDSKALALYSGGLASTGNGVTTTTLSKKRAKKIERNKRYVAKRNEQLNIDLAVKQEGMDIDMEPQGKRVKPQKAPTTLDKVKEALWAAVEDSTSGDMGLNVSSEGTTIGIQAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.39
4 0.39
5 0.4
6 0.39
7 0.33
8 0.28
9 0.27
10 0.21
11 0.19
12 0.17
13 0.14
14 0.15
15 0.19
16 0.2
17 0.25
18 0.26
19 0.29
20 0.29
21 0.31
22 0.32
23 0.35
24 0.39
25 0.32
26 0.36
27 0.34
28 0.37
29 0.37
30 0.33
31 0.3
32 0.3
33 0.31
34 0.27
35 0.28
36 0.32
37 0.35
38 0.38
39 0.39
40 0.4
41 0.41
42 0.44
43 0.43
44 0.39
45 0.42
46 0.43
47 0.43
48 0.43
49 0.44
50 0.45
51 0.51
52 0.54
53 0.54
54 0.57
55 0.57
56 0.53
57 0.54
58 0.52
59 0.5
60 0.51
61 0.51
62 0.52
63 0.53
64 0.56
65 0.58
66 0.61
67 0.6
68 0.59
69 0.59
70 0.6
71 0.57
72 0.54
73 0.48
74 0.42
75 0.41
76 0.44
77 0.4
78 0.33
79 0.34
80 0.39
81 0.45
82 0.52
83 0.54
84 0.56
85 0.6
86 0.65
87 0.69
88 0.67
89 0.62
90 0.57
91 0.55
92 0.48
93 0.43
94 0.39
95 0.36
96 0.36
97 0.37
98 0.36
99 0.34
100 0.33
101 0.34
102 0.32
103 0.28
104 0.27
105 0.25
106 0.25
107 0.23
108 0.23
109 0.19
110 0.18
111 0.17
112 0.14
113 0.13
114 0.11
115 0.1
116 0.07
117 0.06
118 0.05
119 0.04
120 0.03
121 0.03
122 0.04
123 0.04
124 0.03
125 0.04
126 0.04
127 0.04
128 0.05
129 0.07
130 0.1
131 0.14
132 0.18
133 0.26
134 0.33
135 0.41
136 0.51
137 0.58
138 0.65
139 0.72
140 0.8
141 0.83
142 0.83
143 0.83
144 0.82
145 0.83
146 0.83
147 0.81
148 0.79
149 0.76
150 0.75
151 0.72
152 0.65
153 0.56
154 0.49
155 0.41
156 0.33
157 0.26
158 0.2
159 0.16
160 0.14
161 0.13
162 0.11
163 0.09
164 0.08
165 0.08
166 0.08
167 0.08
168 0.11
169 0.12
170 0.11
171 0.14
172 0.18
173 0.19
174 0.26
175 0.33
176 0.4
177 0.48
178 0.58
179 0.64
180 0.68
181 0.73
182 0.72
183 0.74
184 0.7
185 0.65
186 0.58
187 0.49
188 0.41
189 0.4
190 0.34
191 0.25
192 0.21
193 0.18
194 0.16
195 0.16
196 0.15
197 0.11
198 0.1
199 0.1
200 0.09
201 0.08
202 0.07
203 0.06
204 0.07
205 0.07
206 0.07
207 0.06
208 0.06
209 0.06
210 0.06
211 0.06
212 0.07
213 0.06