Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4Y6S0

Protein Details
Accession C4Y6S0   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MQTKRRQDTEDKSRKRSRSEBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito_nucl 12.999, cyto_nucl 12.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
KEGG clu:CLUG_03854  -  
Pfam View protein in Pfam  
PF13893  RRM_5  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MQTKRRQDTEDKSRKRSRSELSQTLYVNNLNDKINRTLLKHNIYILFSTYGEVWDINMKLRGQAHVIMDSKETASVCLKALSGIPMFGKHLRIDFSKNKSKSVEQAEKLLAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.76
4 0.72
5 0.72
6 0.73
7 0.72
8 0.68
9 0.68
10 0.61
11 0.54
12 0.49
13 0.39
14 0.3
15 0.23
16 0.21
17 0.17
18 0.18
19 0.2
20 0.21
21 0.25
22 0.26
23 0.27
24 0.31
25 0.36
26 0.39
27 0.36
28 0.35
29 0.33
30 0.31
31 0.28
32 0.23
33 0.18
34 0.14
35 0.13
36 0.11
37 0.09
38 0.08
39 0.08
40 0.06
41 0.07
42 0.07
43 0.08
44 0.1
45 0.09
46 0.11
47 0.12
48 0.12
49 0.11
50 0.14
51 0.14
52 0.16
53 0.17
54 0.16
55 0.16
56 0.16
57 0.14
58 0.13
59 0.12
60 0.09
61 0.1
62 0.1
63 0.1
64 0.11
65 0.1
66 0.1
67 0.1
68 0.11
69 0.1
70 0.1
71 0.1
72 0.11
73 0.14
74 0.15
75 0.17
76 0.15
77 0.17
78 0.19
79 0.21
80 0.28
81 0.33
82 0.4
83 0.48
84 0.48
85 0.51
86 0.53
87 0.54
88 0.55
89 0.57
90 0.59
91 0.51
92 0.55
93 0.53