Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4Y631

Protein Details
Accession C4Y631   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
32-52AKSLKQGRKKDTQRYFRYRVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 6.5, cyto_nucl 6.5, nucl 5.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007667  Hypoxia_induced_domain  
Gene Ontology GO:0031966  C:mitochondrial membrane  
KEGG clu:CLUG_03615  -  
Pfam View protein in Pfam  
PF04588  HIG_1_N  
PROSITE View protein in PROSITE  
PS51503  HIG1  
Amino Acid Sequences MNTLQKIAYRSKQQPLVPLGTLLTTAAVVLAAKSLKQGRKKDTQRYFRYRVGFQAFTLVALVIGGMYYQKESAEQKQTREDKLREKAKLREQLWIEELERRDQLIKARKQRLEESKKELMKVAQEGFEQERERELKKEDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.59
3 0.56
4 0.47
5 0.42
6 0.34
7 0.26
8 0.24
9 0.17
10 0.11
11 0.07
12 0.06
13 0.05
14 0.04
15 0.04
16 0.04
17 0.05
18 0.05
19 0.05
20 0.09
21 0.15
22 0.21
23 0.3
24 0.37
25 0.42
26 0.52
27 0.61
28 0.68
29 0.72
30 0.77
31 0.79
32 0.81
33 0.81
34 0.76
35 0.72
36 0.62
37 0.59
38 0.54
39 0.45
40 0.36
41 0.34
42 0.27
43 0.23
44 0.22
45 0.15
46 0.08
47 0.07
48 0.07
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.03
55 0.03
56 0.03
57 0.05
58 0.07
59 0.12
60 0.22
61 0.24
62 0.26
63 0.34
64 0.37
65 0.4
66 0.46
67 0.45
68 0.44
69 0.51
70 0.56
71 0.53
72 0.55
73 0.58
74 0.6
75 0.65
76 0.58
77 0.56
78 0.5
79 0.48
80 0.44
81 0.39
82 0.32
83 0.27
84 0.28
85 0.23
86 0.22
87 0.2
88 0.2
89 0.19
90 0.26
91 0.31
92 0.38
93 0.45
94 0.54
95 0.57
96 0.6
97 0.68
98 0.71
99 0.71
100 0.69
101 0.67
102 0.67
103 0.66
104 0.63
105 0.57
106 0.48
107 0.43
108 0.42
109 0.36
110 0.3
111 0.27
112 0.3
113 0.3
114 0.33
115 0.3
116 0.25
117 0.29
118 0.3
119 0.32
120 0.33