Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4Y5P0

Protein Details
Accession C4Y5P0    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
95-115AGPGKVVSERKKPFKRAKRAFBasic
NLS Segment(s)
PositionSequence
94-115GAGPGKVVSERKKPFKRAKRAF
Subcellular Location(s) mito 15.5, mito_nucl 12, nucl 7.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005634  C:nucleus  
GO:0120114  C:Sm-like protein family complex  
GO:0006396  P:RNA processing  
KEGG clu:CLUG_03474  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
Amino Acid Sequences MKLVRFLMTLPSATNQPVTVELKNGNSVNGQILSCSPSMNLSMKNIKLIQPHQDPQLMQFMNIRGNQIRQILLPDDLNIESLLSRSTVKMKGSGAGPGKVVSERKKPFKRAKRAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.14
3 0.13
4 0.17
5 0.19
6 0.18
7 0.19
8 0.21
9 0.21
10 0.26
11 0.25
12 0.21
13 0.18
14 0.18
15 0.18
16 0.17
17 0.15
18 0.11
19 0.11
20 0.13
21 0.12
22 0.11
23 0.09
24 0.08
25 0.11
26 0.12
27 0.13
28 0.14
29 0.19
30 0.19
31 0.22
32 0.22
33 0.22
34 0.25
35 0.26
36 0.3
37 0.3
38 0.31
39 0.31
40 0.32
41 0.29
42 0.26
43 0.31
44 0.24
45 0.19
46 0.19
47 0.17
48 0.19
49 0.19
50 0.2
51 0.13
52 0.14
53 0.17
54 0.16
55 0.16
56 0.13
57 0.14
58 0.14
59 0.14
60 0.13
61 0.11
62 0.11
63 0.11
64 0.11
65 0.09
66 0.08
67 0.07
68 0.07
69 0.07
70 0.06
71 0.07
72 0.07
73 0.12
74 0.15
75 0.16
76 0.19
77 0.2
78 0.22
79 0.22
80 0.28
81 0.28
82 0.26
83 0.25
84 0.23
85 0.24
86 0.24
87 0.29
88 0.29
89 0.35
90 0.42
91 0.53
92 0.61
93 0.7
94 0.77
95 0.82