Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4XZY2

Protein Details
Accession C4XZY2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-32QTIVRKCQTHKNQPAYKRRLNRFSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034105  Lsm3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR040002  Sm-like_LSM3  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0005688  C:U6 snRNP  
GO:0003723  F:RNA binding  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG clu:CLUG_01514  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01730  LSm3  
Amino Acid Sequences MIEHYELMQTIVRKCQTHKNQPAYKRRLNRFSVHNRLNNFILMSNIQTGAQQEEPLDLIRYQLDESVLVKLRGAREMKGKLQGYDSHCNMVLSDAQETIYGENEEDTVVKKTEMVFVRGDSVILISPSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.41
3 0.49
4 0.57
5 0.65
6 0.68
7 0.72
8 0.8
9 0.87
10 0.85
11 0.84
12 0.83
13 0.82
14 0.8
15 0.77
16 0.73
17 0.72
18 0.74
19 0.75
20 0.72
21 0.68
22 0.62
23 0.6
24 0.55
25 0.46
26 0.36
27 0.26
28 0.2
29 0.15
30 0.14
31 0.11
32 0.1
33 0.09
34 0.09
35 0.09
36 0.1
37 0.1
38 0.09
39 0.08
40 0.08
41 0.09
42 0.09
43 0.1
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.06
52 0.07
53 0.09
54 0.1
55 0.1
56 0.1
57 0.11
58 0.12
59 0.16
60 0.17
61 0.16
62 0.21
63 0.25
64 0.27
65 0.33
66 0.33
67 0.29
68 0.3
69 0.34
70 0.34
71 0.38
72 0.36
73 0.31
74 0.3
75 0.29
76 0.27
77 0.22
78 0.18
79 0.12
80 0.11
81 0.1
82 0.1
83 0.1
84 0.1
85 0.1
86 0.09
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.08
93 0.09
94 0.1
95 0.11
96 0.11
97 0.12
98 0.12
99 0.2
100 0.22
101 0.23
102 0.21
103 0.22
104 0.25
105 0.24
106 0.23
107 0.16
108 0.15
109 0.13
110 0.12