Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4YAM2

Protein Details
Accession C4YAM2    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MHHHAPDVRREKRPHRRGHGRNHQQRVEKRRRVVBasic
131-157GGPEEKSVRPPHRHHRRHQHLGVPPVDBasic
NLS Segment(s)
PositionSequence
9-32RREKRPHRRGHGRNHQQRVEKRRR
104-147RQVARRNGVGDIARARARRKVKVPPVEGGPEEKSVRPPHRHHRR
Subcellular Location(s) mito 12, nucl 10, cyto 4
Family & Domain DBs
KEGG clu:CLUG_05250  -  
Amino Acid Sequences MHHHAPDVRREKRPHRRGHGRNHQQRVEKRRRVVVAAAGRELARLEQKQRLDQAPGQAAPGGEGPETGSGAARPDTGPQPERAVRLGHLRPERGAARTQVSERRQVARRNGVGDIARARARRKVKVPPVEGGPEEKSVRPPHRHHRRHQHLGVPPVDVGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.88
4 0.88
5 0.91
6 0.91
7 0.91
8 0.92
9 0.9
10 0.87
11 0.85
12 0.84
13 0.84
14 0.84
15 0.81
16 0.76
17 0.75
18 0.7
19 0.64
20 0.58
21 0.56
22 0.52
23 0.46
24 0.41
25 0.34
26 0.31
27 0.28
28 0.25
29 0.18
30 0.15
31 0.16
32 0.19
33 0.24
34 0.26
35 0.29
36 0.33
37 0.34
38 0.33
39 0.33
40 0.35
41 0.32
42 0.3
43 0.27
44 0.24
45 0.21
46 0.17
47 0.16
48 0.11
49 0.07
50 0.07
51 0.07
52 0.06
53 0.07
54 0.06
55 0.05
56 0.04
57 0.06
58 0.06
59 0.06
60 0.06
61 0.08
62 0.1
63 0.13
64 0.14
65 0.15
66 0.18
67 0.19
68 0.2
69 0.2
70 0.18
71 0.17
72 0.22
73 0.23
74 0.26
75 0.27
76 0.27
77 0.25
78 0.29
79 0.29
80 0.24
81 0.24
82 0.2
83 0.2
84 0.21
85 0.24
86 0.28
87 0.28
88 0.33
89 0.34
90 0.39
91 0.41
92 0.46
93 0.51
94 0.52
95 0.52
96 0.47
97 0.45
98 0.42
99 0.37
100 0.33
101 0.28
102 0.22
103 0.24
104 0.23
105 0.25
106 0.29
107 0.35
108 0.39
109 0.44
110 0.51
111 0.57
112 0.65
113 0.67
114 0.63
115 0.62
116 0.59
117 0.54
118 0.47
119 0.4
120 0.35
121 0.33
122 0.3
123 0.31
124 0.35
125 0.43
126 0.47
127 0.53
128 0.59
129 0.69
130 0.77
131 0.81
132 0.84
133 0.87
134 0.89
135 0.88
136 0.85
137 0.82
138 0.81
139 0.72
140 0.63