Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PPR2

Protein Details
Accession D8PPR2   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MAVKIPIVKKRTNKFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
9-47KKRTNKFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQ
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG scm:SCHCO_02611794  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAVKIPIVKKRTNKFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQTAMPKIGYGSNKKTRHVLPNGLKKFLVSNTREVDLLLMHNQSYAAEIAHNVSSRNRTAILERAKVLGVKVTNSAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.86
3 0.9
4 0.91
5 0.9
6 0.89
7 0.88
8 0.87
9 0.84
10 0.78
11 0.68
12 0.64
13 0.62
14 0.61
15 0.61
16 0.61
17 0.59
18 0.57
19 0.58
20 0.61
21 0.63
22 0.64
23 0.64
24 0.66
25 0.71
26 0.78
27 0.83
28 0.76
29 0.74
30 0.71
31 0.67
32 0.66
33 0.61
34 0.62
35 0.63
36 0.64
37 0.56
38 0.5
39 0.44
40 0.38
41 0.35
42 0.29
43 0.29
44 0.35
45 0.37
46 0.38
47 0.41
48 0.42
49 0.45
50 0.45
51 0.47
52 0.45
53 0.53
54 0.54
55 0.52
56 0.47
57 0.4
58 0.37
59 0.32
60 0.31
61 0.22
62 0.26
63 0.26
64 0.27
65 0.27
66 0.25
67 0.22
68 0.15
69 0.14
70 0.11
71 0.09
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.07
78 0.06
79 0.05
80 0.06
81 0.08
82 0.1
83 0.1
84 0.1
85 0.13
86 0.16
87 0.17
88 0.19
89 0.19
90 0.18
91 0.21
92 0.29
93 0.33
94 0.33
95 0.33
96 0.33
97 0.32
98 0.31
99 0.29
100 0.26
101 0.2
102 0.18
103 0.19
104 0.21
105 0.22
106 0.23
107 0.26
108 0.23