Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8Q5A9

Protein Details
Accession D8Q5A9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-36KDPDTKTRRKAATKSEKTPRKAKKDPNAPKRALSBasic
NLS Segment(s)
PositionSequence
8-33KTRRKAATKSEKTPRKAKKDPNAPKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKDPDTKTRRKAATKSEKTPRKAKKDPNAPKRALSAYMFFSQDWRERVKAENPDASFGELGKILGAKWKEMDEDEKKPYVAKAAKDKERAEADKAAYDEKKSAEASEADEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.81
4 0.82
5 0.82
6 0.8
7 0.82
8 0.81
9 0.8
10 0.8
11 0.81
12 0.81
13 0.83
14 0.88
15 0.89
16 0.88
17 0.81
18 0.73
19 0.67
20 0.59
21 0.51
22 0.42
23 0.33
24 0.27
25 0.27
26 0.26
27 0.21
28 0.2
29 0.2
30 0.22
31 0.21
32 0.21
33 0.19
34 0.19
35 0.23
36 0.28
37 0.31
38 0.31
39 0.34
40 0.31
41 0.33
42 0.32
43 0.29
44 0.23
45 0.16
46 0.13
47 0.08
48 0.07
49 0.05
50 0.05
51 0.04
52 0.08
53 0.09
54 0.09
55 0.1
56 0.1
57 0.11
58 0.12
59 0.2
60 0.21
61 0.26
62 0.29
63 0.29
64 0.29
65 0.29
66 0.28
67 0.29
68 0.28
69 0.28
70 0.35
71 0.42
72 0.5
73 0.56
74 0.56
75 0.55
76 0.58
77 0.56
78 0.5
79 0.46
80 0.41
81 0.38
82 0.38
83 0.37
84 0.31
85 0.3
86 0.28
87 0.24
88 0.26
89 0.23
90 0.23
91 0.21
92 0.2
93 0.23
94 0.25