Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8Q043

Protein Details
Accession D8Q043    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
30-49IVIGKPKKPNSAKRKVARIKHydrophilic
NLS Segment(s)
PositionSequence
2-26RRKRPKKASKGKSPLLEGAPQRKGV
31-49VIGKPKKPNSAKRKVARIK
109-117RYGAKKPKK
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG scm:SCHCO_02615426  -  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MRRKRPKKASKGKSPLLEGAPQRKGVVTQIVIGKPKKPNSAKRKVARIKLSTGKPLQAYIPGEGHNLQEHSVVLVRGGAAQDLPGVRYRLVRGALDLGGVVNRVSARSRYGAKKPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.73
3 0.65
4 0.61
5 0.55
6 0.54
7 0.49
8 0.43
9 0.39
10 0.34
11 0.31
12 0.27
13 0.27
14 0.19
15 0.2
16 0.24
17 0.26
18 0.3
19 0.31
20 0.33
21 0.35
22 0.39
23 0.44
24 0.47
25 0.55
26 0.61
27 0.7
28 0.75
29 0.75
30 0.81
31 0.79
32 0.8
33 0.77
34 0.7
35 0.66
36 0.64
37 0.6
38 0.55
39 0.49
40 0.43
41 0.35
42 0.32
43 0.26
44 0.22
45 0.2
46 0.15
47 0.15
48 0.13
49 0.14
50 0.14
51 0.14
52 0.11
53 0.1
54 0.09
55 0.09
56 0.08
57 0.08
58 0.08
59 0.08
60 0.07
61 0.06
62 0.06
63 0.06
64 0.06
65 0.05
66 0.04
67 0.04
68 0.06
69 0.06
70 0.07
71 0.09
72 0.1
73 0.11
74 0.13
75 0.15
76 0.18
77 0.2
78 0.19
79 0.18
80 0.19
81 0.19
82 0.17
83 0.15
84 0.11
85 0.09
86 0.09
87 0.08
88 0.06
89 0.07
90 0.08
91 0.1
92 0.12
93 0.15
94 0.2
95 0.27
96 0.33
97 0.44