Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0U7S5

Protein Details
Accession Q0U7S5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
31-60LDKNHSRNVRPVRTRRRRNRCNGYKPPPIQHydrophilic
NLS Segment(s)
PositionSequence
40-48RPVRTRRRR
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
KEGG pno:SNOG_12189  -  
Amino Acid Sequences MAVTFVCLSRSQSSLNDALSIYTKRKHEASLDKNHSRNVRPVRTRRRRNRCNGYKPPPIQYENSDATTKWYHAKNAEACMSVQSSVLARTEKKPCPGAECEKMGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.22
4 0.19
5 0.19
6 0.2
7 0.2
8 0.19
9 0.21
10 0.22
11 0.24
12 0.26
13 0.27
14 0.32
15 0.4
16 0.45
17 0.51
18 0.58
19 0.62
20 0.62
21 0.64
22 0.61
23 0.53
24 0.54
25 0.52
26 0.52
27 0.55
28 0.63
29 0.7
30 0.76
31 0.84
32 0.86
33 0.88
34 0.89
35 0.9
36 0.91
37 0.91
38 0.9
39 0.9
40 0.87
41 0.85
42 0.77
43 0.73
44 0.66
45 0.58
46 0.5
47 0.42
48 0.4
49 0.33
50 0.34
51 0.28
52 0.24
53 0.25
54 0.24
55 0.22
56 0.22
57 0.21
58 0.21
59 0.23
60 0.3
61 0.29
62 0.32
63 0.33
64 0.29
65 0.28
66 0.26
67 0.25
68 0.19
69 0.16
70 0.12
71 0.1
72 0.1
73 0.12
74 0.14
75 0.15
76 0.21
77 0.3
78 0.34
79 0.4
80 0.44
81 0.44
82 0.48
83 0.53
84 0.55
85 0.54