Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7TMR0

Protein Details
Accession A7TMR0    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-59ALPPLKYKYDPKRVKKSDGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.333, mito_nucl 11.333, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040474  Get5_C  
IPR031765  Mdy2_get4-bd  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
KEGG vpo:Kpol_1066p41  -  
Pfam View protein in Pfam  
PF16843  Get5_bdg  
PF18514  Get5_C  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MTTTESEFVSKFLTLATLSDPILWRDYQKPLKEVKSLGVALPPLKYKYDPKRVKKSDGSASSIKLTLKSVRAPKFSVEQKFSTNDTVYQVKQLLVAEGQVEHVEQLKLLLKGKVLHDKMLLADFNLSDATLNVMVSKAPVKEINTEGASEIETNSTNIDLSNLEVPWNEIELLLKTKFNNDKHASLTLQRLQKGWELTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.12
5 0.12
6 0.15
7 0.16
8 0.16
9 0.18
10 0.18
11 0.19
12 0.21
13 0.31
14 0.36
15 0.39
16 0.43
17 0.47
18 0.52
19 0.53
20 0.5
21 0.44
22 0.42
23 0.39
24 0.34
25 0.29
26 0.26
27 0.22
28 0.23
29 0.23
30 0.18
31 0.19
32 0.21
33 0.28
34 0.36
35 0.46
36 0.54
37 0.61
38 0.71
39 0.75
40 0.8
41 0.78
42 0.75
43 0.74
44 0.68
45 0.64
46 0.55
47 0.51
48 0.44
49 0.39
50 0.32
51 0.23
52 0.21
53 0.19
54 0.19
55 0.23
56 0.3
57 0.33
58 0.36
59 0.36
60 0.36
61 0.39
62 0.43
63 0.43
64 0.39
65 0.36
66 0.35
67 0.37
68 0.36
69 0.32
70 0.26
71 0.21
72 0.2
73 0.21
74 0.18
75 0.18
76 0.17
77 0.14
78 0.15
79 0.14
80 0.11
81 0.08
82 0.08
83 0.07
84 0.06
85 0.06
86 0.05
87 0.04
88 0.04
89 0.05
90 0.05
91 0.05
92 0.06
93 0.08
94 0.09
95 0.11
96 0.11
97 0.11
98 0.14
99 0.17
100 0.25
101 0.23
102 0.23
103 0.22
104 0.22
105 0.21
106 0.21
107 0.18
108 0.1
109 0.1
110 0.08
111 0.08
112 0.07
113 0.07
114 0.05
115 0.05
116 0.06
117 0.06
118 0.06
119 0.05
120 0.05
121 0.05
122 0.06
123 0.08
124 0.07
125 0.09
126 0.12
127 0.13
128 0.17
129 0.19
130 0.22
131 0.21
132 0.21
133 0.19
134 0.17
135 0.16
136 0.13
137 0.11
138 0.08
139 0.08
140 0.08
141 0.08
142 0.08
143 0.07
144 0.07
145 0.08
146 0.07
147 0.08
148 0.1
149 0.1
150 0.1
151 0.1
152 0.12
153 0.12
154 0.13
155 0.11
156 0.08
157 0.1
158 0.12
159 0.16
160 0.16
161 0.17
162 0.16
163 0.24
164 0.32
165 0.34
166 0.42
167 0.43
168 0.46
169 0.47
170 0.51
171 0.46
172 0.43
173 0.47
174 0.44
175 0.45
176 0.43
177 0.4
178 0.39
179 0.41