Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8QKB8

Protein Details
Accession D8QKB8   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
117-138RAYPRYGRRRGWPRRNPTRALTHydrophilic
189-208ALKTEKTEKRRSWKVFYSLRHydrophilic
NLS Segment(s)
PositionSequence
122-131YGRRRGWPRR
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
KEGG scm:SCHCO_02644950  -  
Amino Acid Sequences MSVMQGVAGSSVHAAEPPPTPQHQPPTPMPSPPVSRSSSPAPGPTSAYKIAPLPSPTPSPYPSRPPTPTHSARAPNAVLNFRPATRDVLRAIVPHVFLESAPGMQNILARQAGLPPRAYPRYGRRRGWPRRNPTRALTARCDGLRARDAMHARGLRYDPRRPLRGSPLRACTHFVIWEDFDEPAPQPDALKTEKTEKRRSWKVFYSLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.11
4 0.15
5 0.19
6 0.22
7 0.27
8 0.33
9 0.41
10 0.43
11 0.47
12 0.5
13 0.54
14 0.54
15 0.51
16 0.48
17 0.46
18 0.47
19 0.44
20 0.43
21 0.39
22 0.38
23 0.4
24 0.42
25 0.42
26 0.38
27 0.38
28 0.36
29 0.33
30 0.35
31 0.33
32 0.32
33 0.27
34 0.26
35 0.23
36 0.22
37 0.22
38 0.22
39 0.23
40 0.2
41 0.21
42 0.24
43 0.25
44 0.26
45 0.27
46 0.3
47 0.31
48 0.38
49 0.4
50 0.44
51 0.45
52 0.47
53 0.5
54 0.53
55 0.54
56 0.5
57 0.52
58 0.5
59 0.47
60 0.47
61 0.41
62 0.35
63 0.33
64 0.3
65 0.24
66 0.23
67 0.22
68 0.18
69 0.19
70 0.17
71 0.2
72 0.19
73 0.21
74 0.18
75 0.2
76 0.2
77 0.19
78 0.19
79 0.15
80 0.14
81 0.11
82 0.1
83 0.08
84 0.07
85 0.08
86 0.07
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.08
93 0.06
94 0.07
95 0.07
96 0.06
97 0.06
98 0.1
99 0.13
100 0.13
101 0.13
102 0.13
103 0.18
104 0.2
105 0.21
106 0.23
107 0.3
108 0.4
109 0.47
110 0.49
111 0.54
112 0.63
113 0.73
114 0.79
115 0.79
116 0.79
117 0.82
118 0.85
119 0.8
120 0.72
121 0.72
122 0.67
123 0.63
124 0.57
125 0.48
126 0.45
127 0.41
128 0.4
129 0.3
130 0.27
131 0.25
132 0.2
133 0.2
134 0.22
135 0.24
136 0.24
137 0.3
138 0.27
139 0.25
140 0.28
141 0.28
142 0.31
143 0.35
144 0.4
145 0.43
146 0.49
147 0.54
148 0.54
149 0.57
150 0.61
151 0.64
152 0.66
153 0.63
154 0.64
155 0.63
156 0.61
157 0.59
158 0.5
159 0.43
160 0.38
161 0.32
162 0.28
163 0.25
164 0.25
165 0.22
166 0.2
167 0.18
168 0.17
169 0.16
170 0.14
171 0.15
172 0.14
173 0.14
174 0.15
175 0.18
176 0.2
177 0.23
178 0.23
179 0.32
180 0.39
181 0.47
182 0.55
183 0.6
184 0.67
185 0.74
186 0.78
187 0.77
188 0.79