Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UWX4

Protein Details
Accession Q0UWX4   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
166-197GKMDKEARKLAKKERAKQERREKEKKRQAEKABasic
NLS Segment(s)
PositionSequence
157-197AKKRKIEEGGKMDKEARKLAKKERAKQERREKEKKRQAEKA
Subcellular Location(s) nucl 13, cyto_nucl 11, mito 7, cyto 7
Family & Domain DBs
KEGG pno:SNOG_03740  -  
Amino Acid Sequences MSLEAPPPARHVSSTPISLTDASRMLETYLANSERHPHLHPDALITPTGVTFSSHGGPMGSVVMHNLRRVAAGMRGEFLEPEKTPEPEEDEVSAKKFSGKKRKDFSTVTDDDWQDKAEYEAEQGAIEVGEIGHRTNVVQEGGEEPEVQVTGGAEEGAKKRKIEEGGKMDKEARKLAKKERAKQERREKEKKRQAEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.26
4 0.27
5 0.27
6 0.25
7 0.22
8 0.19
9 0.17
10 0.16
11 0.15
12 0.14
13 0.14
14 0.14
15 0.13
16 0.16
17 0.17
18 0.17
19 0.17
20 0.22
21 0.23
22 0.26
23 0.26
24 0.26
25 0.28
26 0.33
27 0.32
28 0.32
29 0.31
30 0.29
31 0.27
32 0.22
33 0.18
34 0.14
35 0.14
36 0.09
37 0.08
38 0.07
39 0.09
40 0.1
41 0.1
42 0.1
43 0.1
44 0.09
45 0.09
46 0.08
47 0.06
48 0.05
49 0.06
50 0.1
51 0.11
52 0.12
53 0.12
54 0.12
55 0.12
56 0.13
57 0.13
58 0.12
59 0.14
60 0.13
61 0.13
62 0.14
63 0.14
64 0.13
65 0.13
66 0.12
67 0.1
68 0.14
69 0.15
70 0.15
71 0.16
72 0.16
73 0.2
74 0.18
75 0.19
76 0.16
77 0.17
78 0.17
79 0.17
80 0.17
81 0.12
82 0.15
83 0.18
84 0.24
85 0.33
86 0.39
87 0.47
88 0.53
89 0.58
90 0.6
91 0.57
92 0.55
93 0.53
94 0.48
95 0.42
96 0.4
97 0.36
98 0.32
99 0.3
100 0.26
101 0.17
102 0.15
103 0.13
104 0.09
105 0.09
106 0.08
107 0.08
108 0.08
109 0.07
110 0.07
111 0.06
112 0.05
113 0.04
114 0.04
115 0.03
116 0.03
117 0.04
118 0.04
119 0.04
120 0.04
121 0.05
122 0.06
123 0.08
124 0.07
125 0.07
126 0.08
127 0.09
128 0.11
129 0.12
130 0.11
131 0.09
132 0.09
133 0.09
134 0.08
135 0.07
136 0.05
137 0.05
138 0.05
139 0.05
140 0.04
141 0.07
142 0.11
143 0.18
144 0.2
145 0.2
146 0.22
147 0.28
148 0.35
149 0.37
150 0.43
151 0.46
152 0.54
153 0.56
154 0.56
155 0.57
156 0.53
157 0.51
158 0.49
159 0.48
160 0.47
161 0.52
162 0.59
163 0.64
164 0.71
165 0.77
166 0.81
167 0.84
168 0.84
169 0.88
170 0.89
171 0.9
172 0.9
173 0.91
174 0.9
175 0.9
176 0.92
177 0.92