Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8Q8N0

Protein Details
Accession D8Q8N0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-80LTPERRLKRQPSMSKEKMKKFLHydrophilic
NLS Segment(s)
PositionSequence
64-94RLKRQPSMSKEKMKKFLARASGVLGLGRKKA
Subcellular Location(s) mito 17, nucl 9, cyto_nucl 6
Family & Domain DBs
KEGG scm:SCHCO_02632771  -  
Amino Acid Sequences MPTLASEPVMKLKHRSYAPPPSQNTFLQAPFTHRPSRSTGAATLFPPPPDVHPRSFMDLTPERRLKRQPSMSKEKMKKFLARASGVLGLGRKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.44
4 0.52
5 0.59
6 0.62
7 0.63
8 0.6
9 0.61
10 0.55
11 0.51
12 0.43
13 0.35
14 0.29
15 0.26
16 0.28
17 0.28
18 0.32
19 0.34
20 0.31
21 0.33
22 0.35
23 0.39
24 0.34
25 0.32
26 0.29
27 0.26
28 0.27
29 0.25
30 0.23
31 0.2
32 0.17
33 0.17
34 0.15
35 0.15
36 0.2
37 0.23
38 0.21
39 0.25
40 0.26
41 0.3
42 0.31
43 0.28
44 0.28
45 0.31
46 0.35
47 0.39
48 0.43
49 0.39
50 0.43
51 0.49
52 0.49
53 0.53
54 0.58
55 0.59
56 0.63
57 0.72
58 0.76
59 0.8
60 0.82
61 0.81
62 0.79
63 0.75
64 0.73
65 0.69
66 0.67
67 0.65
68 0.59
69 0.52
70 0.47
71 0.44
72 0.37
73 0.33
74 0.29