Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8QL43

Protein Details
Accession D8QL43   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-52CPHPRPPAVRSSRRPGRRRRRTRHPPTTAQKAGRBasic
NLS Segment(s)
PositionSequence
23-44RPPAVRSSRRPGRRRRRTRHPP
Subcellular Location(s) mito 12, nucl 11, cyto_nucl 8, cyto 3
Family & Domain DBs
KEGG scm:SCHCO_02673518  -  
Amino Acid Sequences MTGVYILGRGSEGWYFPPCPHPRPPAVRSSRRPGRRRRRTRHPPTTAQKAGRALLQSESALRSAPTCSFRTPIKLSEPAVIPLALQGPKHAKSTSIAPRSAPVALADRRDDTRRQTEEGWGRREAARSAAALQAPSVAGNIAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.28
5 0.31
6 0.35
7 0.42
8 0.46
9 0.51
10 0.58
11 0.61
12 0.61
13 0.66
14 0.71
15 0.71
16 0.74
17 0.75
18 0.77
19 0.81
20 0.82
21 0.84
22 0.85
23 0.89
24 0.89
25 0.9
26 0.92
27 0.94
28 0.94
29 0.91
30 0.9
31 0.86
32 0.87
33 0.82
34 0.73
35 0.66
36 0.57
37 0.5
38 0.42
39 0.35
40 0.25
41 0.2
42 0.18
43 0.14
44 0.12
45 0.12
46 0.1
47 0.09
48 0.08
49 0.08
50 0.08
51 0.1
52 0.13
53 0.14
54 0.15
55 0.17
56 0.18
57 0.23
58 0.23
59 0.23
60 0.24
61 0.25
62 0.25
63 0.26
64 0.26
65 0.22
66 0.21
67 0.18
68 0.13
69 0.11
70 0.12
71 0.1
72 0.09
73 0.1
74 0.14
75 0.16
76 0.18
77 0.18
78 0.16
79 0.17
80 0.25
81 0.33
82 0.33
83 0.33
84 0.31
85 0.32
86 0.33
87 0.31
88 0.24
89 0.16
90 0.17
91 0.18
92 0.2
93 0.21
94 0.22
95 0.25
96 0.28
97 0.3
98 0.3
99 0.38
100 0.38
101 0.4
102 0.39
103 0.45
104 0.51
105 0.55
106 0.53
107 0.45
108 0.44
109 0.43
110 0.44
111 0.36
112 0.31
113 0.25
114 0.22
115 0.23
116 0.24
117 0.23
118 0.2
119 0.19
120 0.16
121 0.14
122 0.13
123 0.11