Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8QLK6

Protein Details
Accession D8QLK6    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-56VVYPPLPRHRRPPQRPRQILVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, extr 5, nucl 4.5, cyto_nucl 3
Family & Domain DBs
KEGG scm:SCHCO_02645858  -  
Amino Acid Sequences MPPRLPSSPAPSPPPHLLYLSLSPLPPLTPLPPRLVVYPPLPRHRRPPQRPRQILVHDKRDARAREDADDVCAGVGLGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.44
3 0.37
4 0.33
5 0.3
6 0.3
7 0.27
8 0.24
9 0.2
10 0.18
11 0.17
12 0.16
13 0.13
14 0.12
15 0.11
16 0.15
17 0.17
18 0.2
19 0.22
20 0.23
21 0.24
22 0.24
23 0.24
24 0.23
25 0.29
26 0.31
27 0.37
28 0.4
29 0.4
30 0.47
31 0.55
32 0.63
33 0.65
34 0.72
35 0.74
36 0.81
37 0.85
38 0.8
39 0.78
40 0.75
41 0.75
42 0.72
43 0.7
44 0.64
45 0.61
46 0.6
47 0.59
48 0.53
49 0.47
50 0.47
51 0.41
52 0.38
53 0.41
54 0.38
55 0.33
56 0.31
57 0.26
58 0.18
59 0.16
60 0.12