Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8QLA2

Protein Details
Accession D8QLA2    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-91DFVVPSRRRLRRRGPRSVRRGRSGVBasic
NLS Segment(s)
PositionSequence
73-88RRRLRRRGPRSVRRGR
Subcellular Location(s) extr 14, plas 4, mito 2, pero 2, E.R. 2, nucl 1, cyto 1, cyto_nucl 1, vacu 1
Family & Domain DBs
KEGG scm:SCHCO_02594642  -  
Amino Acid Sequences MSTSSSSPAVDFVLVESYAVDFVVEPPAVDLVVGSYAVDVVVVALLAVDFDVGSPAADFVVESLAVDFVVPSRRRLRRRGPRSVRRGRSGVALSTSLSSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.08
5 0.08
6 0.08
7 0.07
8 0.04
9 0.05
10 0.08
11 0.08
12 0.07
13 0.08
14 0.08
15 0.08
16 0.07
17 0.06
18 0.04
19 0.04
20 0.04
21 0.04
22 0.03
23 0.03
24 0.03
25 0.03
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.01
37 0.02
38 0.02
39 0.02
40 0.02
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.04
53 0.04
54 0.03
55 0.04
56 0.12
57 0.13
58 0.17
59 0.26
60 0.35
61 0.41
62 0.5
63 0.6
64 0.64
65 0.73
66 0.8
67 0.82
68 0.84
69 0.9
70 0.92
71 0.89
72 0.85
73 0.8
74 0.7
75 0.66
76 0.59
77 0.51
78 0.43
79 0.36
80 0.3