Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8QG09

Protein Details
Accession D8QG09    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-37GTRSWAVRSARRRPIRPRNPAWPPIPHydrophilic
111-133RAPSPSRSRCGPRSQWRRRWCSAHydrophilic
NLS Segment(s)
PositionSequence
20-31SARRRPIRPRNP
Subcellular Location(s) nucl 13, mito 12, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MSSGMRCPGRLGTRSWAVRSARRRPIRPRNPAWPPIPARLPQLPALPHRLPSTPPPLPPLPPPLFHHSPAPIAPSSTPSSPTSASWATPTGLPTSPSPSPGCAPCASAPGRAPSPSRSRCGPRSQWRRRWCSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.47
4 0.44
5 0.5
6 0.55
7 0.58
8 0.59
9 0.65
10 0.71
11 0.75
12 0.82
13 0.84
14 0.86
15 0.83
16 0.83
17 0.82
18 0.81
19 0.73
20 0.7
21 0.64
22 0.59
23 0.56
24 0.47
25 0.44
26 0.4
27 0.4
28 0.33
29 0.33
30 0.3
31 0.28
32 0.34
33 0.29
34 0.29
35 0.28
36 0.27
37 0.25
38 0.27
39 0.32
40 0.27
41 0.27
42 0.3
43 0.29
44 0.3
45 0.3
46 0.34
47 0.28
48 0.28
49 0.31
50 0.34
51 0.35
52 0.34
53 0.34
54 0.27
55 0.26
56 0.23
57 0.22
58 0.15
59 0.13
60 0.12
61 0.14
62 0.15
63 0.14
64 0.17
65 0.15
66 0.17
67 0.17
68 0.18
69 0.19
70 0.17
71 0.17
72 0.16
73 0.16
74 0.14
75 0.14
76 0.15
77 0.13
78 0.14
79 0.15
80 0.14
81 0.19
82 0.19
83 0.21
84 0.21
85 0.2
86 0.22
87 0.22
88 0.25
89 0.2
90 0.23
91 0.21
92 0.25
93 0.24
94 0.25
95 0.25
96 0.27
97 0.29
98 0.28
99 0.3
100 0.31
101 0.4
102 0.41
103 0.44
104 0.46
105 0.52
106 0.57
107 0.64
108 0.68
109 0.69
110 0.75
111 0.82
112 0.85
113 0.87