Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8QD93

Protein Details
Accession D8QD93    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
206-232QDLTNPGQRRRSRSKLRRLTAHVKHKSHydrophilic
NLS Segment(s)
PositionSequence
214-231RRRSRSKLRRLTAHVKHK
Subcellular Location(s) plas 20, E.R. 3, mito 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVPFGIRILWFVLSSVGLLVCWVVFLAVGRALGNLWAPLAYLAACTTMQVTFLLGMIWRMDTHLMPKSFCIVQTTMFTLSDFMMTGVAVTFTCATAMCVIKPKTWGESQTNTLKWRPIYIMPVVVLPVLLTAVQTGLYIHFDAVGPSGAIHCDANDPIWVRFFGYAGIPLLACFPCLILTVVSIRRVWRTNAHIQRSWQQEFMAAQDLTNPGQRRRSRSKLRRLTAHVKHKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.08
4 0.06
5 0.06
6 0.06
7 0.04
8 0.04
9 0.04
10 0.03
11 0.03
12 0.04
13 0.06
14 0.07
15 0.07
16 0.07
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.07
31 0.07
32 0.07
33 0.08
34 0.07
35 0.08
36 0.07
37 0.08
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.08
48 0.08
49 0.11
50 0.17
51 0.18
52 0.18
53 0.19
54 0.21
55 0.21
56 0.21
57 0.21
58 0.15
59 0.16
60 0.17
61 0.19
62 0.17
63 0.16
64 0.16
65 0.13
66 0.12
67 0.11
68 0.09
69 0.07
70 0.05
71 0.05
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.07
83 0.08
84 0.08
85 0.14
86 0.15
87 0.16
88 0.19
89 0.19
90 0.2
91 0.22
92 0.25
93 0.23
94 0.25
95 0.29
96 0.32
97 0.33
98 0.32
99 0.32
100 0.3
101 0.26
102 0.24
103 0.21
104 0.17
105 0.18
106 0.17
107 0.17
108 0.14
109 0.14
110 0.13
111 0.11
112 0.09
113 0.06
114 0.05
115 0.03
116 0.03
117 0.03
118 0.02
119 0.03
120 0.03
121 0.03
122 0.03
123 0.04
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.05
133 0.05
134 0.05
135 0.05
136 0.06
137 0.05
138 0.05
139 0.06
140 0.07
141 0.07
142 0.09
143 0.11
144 0.11
145 0.12
146 0.12
147 0.11
148 0.12
149 0.11
150 0.1
151 0.09
152 0.09
153 0.09
154 0.09
155 0.08
156 0.08
157 0.1
158 0.09
159 0.09
160 0.07
161 0.07
162 0.07
163 0.08
164 0.09
165 0.07
166 0.08
167 0.12
168 0.14
169 0.16
170 0.17
171 0.17
172 0.21
173 0.24
174 0.26
175 0.28
176 0.33
177 0.42
178 0.5
179 0.56
180 0.55
181 0.57
182 0.62
183 0.63
184 0.59
185 0.49
186 0.4
187 0.37
188 0.33
189 0.32
190 0.31
191 0.22
192 0.19
193 0.2
194 0.22
195 0.2
196 0.26
197 0.27
198 0.25
199 0.34
200 0.4
201 0.46
202 0.55
203 0.64
204 0.69
205 0.76
206 0.83
207 0.85
208 0.88
209 0.89
210 0.88
211 0.88
212 0.87