Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R1K7

Protein Details
Accession C4R1K7   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
115-138AEVPREIKAKPEKKKEQPKGDAELBasic
NLS Segment(s)
PositionSequence
121-183IKAKPEKKKEQPKGDAELQKPQKSKAQDKPEGKPTGPPQDEAARKAAKEAKEAKKAAKAKARA
Subcellular Location(s) nucl 17, cyto_nucl 13.333, mito_nucl 9.333, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR012340  NA-bd_OB-fold  
IPR002547  tRNA-bd_dom  
Gene Ontology GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0017102  C:methionyl glutamyl tRNA synthetase complex  
GO:0008047  F:enzyme activator activity  
GO:0080025  F:phosphatidylinositol-3,5-bisphosphate binding  
GO:0032266  F:phosphatidylinositol-3-phosphate binding  
GO:0000049  F:tRNA binding  
GO:0001731  P:formation of translation preinitiation complex  
GO:0006418  P:tRNA aminoacylation for protein translation  
KEGG ppa:PAS_chr2-1_0731  -  
Pfam View protein in Pfam  
PF01588  tRNA_bind  
PROSITE View protein in PROSITE  
PS50886  TRBD  
CDD cd02799  tRNA_bind_EMAP-II_like  
Amino Acid Sequences MSDLEQPLQKLRIDVSAFPKLSAEEAALASQWTTLALRLPENLAKLNEFLKTRTYIVGNSPSEADVDVFSQTESMLRSWSSIEDLSRYRHIIRWADLVQHTLLEPKTPFTVNYSAEVPREIKAKPEKKKEQPKGDAELQKPQKSKAQDKPEGKPTGPPQDEAARKAAKEAKEAKKAAKAKARAELEAKANASQVPPNPSMVDFRVGFIQKAVKHPDADSLYVSTIDMGDPEGPRTVCSGLVKYVPIEDMQQRYVVVIANLKPVNMRGIKSSAMVLCASKKEIDRVEFVNPPEGAAAGDKIFFEGFDGTPEKQLNPKKKIFETVQPRFTTNEAFEVLYQEEGKPAAKLVHSSGALCHASTLVGAQVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.41
4 0.41
5 0.39
6 0.39
7 0.32
8 0.3
9 0.26
10 0.2
11 0.13
12 0.13
13 0.13
14 0.12
15 0.12
16 0.1
17 0.1
18 0.08
19 0.07
20 0.07
21 0.07
22 0.11
23 0.13
24 0.14
25 0.15
26 0.19
27 0.21
28 0.23
29 0.26
30 0.23
31 0.23
32 0.23
33 0.24
34 0.24
35 0.23
36 0.22
37 0.23
38 0.24
39 0.24
40 0.26
41 0.26
42 0.23
43 0.28
44 0.35
45 0.32
46 0.3
47 0.3
48 0.26
49 0.25
50 0.23
51 0.18
52 0.1
53 0.1
54 0.09
55 0.08
56 0.08
57 0.08
58 0.07
59 0.08
60 0.09
61 0.08
62 0.09
63 0.09
64 0.1
65 0.11
66 0.12
67 0.13
68 0.13
69 0.13
70 0.16
71 0.18
72 0.21
73 0.23
74 0.25
75 0.24
76 0.26
77 0.32
78 0.32
79 0.32
80 0.35
81 0.33
82 0.36
83 0.35
84 0.33
85 0.27
86 0.23
87 0.21
88 0.18
89 0.17
90 0.14
91 0.14
92 0.14
93 0.16
94 0.16
95 0.16
96 0.17
97 0.22
98 0.2
99 0.22
100 0.23
101 0.22
102 0.22
103 0.24
104 0.2
105 0.17
106 0.18
107 0.16
108 0.21
109 0.3
110 0.38
111 0.45
112 0.55
113 0.63
114 0.71
115 0.82
116 0.85
117 0.85
118 0.84
119 0.81
120 0.77
121 0.76
122 0.73
123 0.63
124 0.63
125 0.59
126 0.56
127 0.52
128 0.47
129 0.44
130 0.43
131 0.5
132 0.5
133 0.54
134 0.57
135 0.61
136 0.65
137 0.69
138 0.66
139 0.57
140 0.54
141 0.48
142 0.49
143 0.45
144 0.39
145 0.33
146 0.37
147 0.38
148 0.35
149 0.35
150 0.26
151 0.25
152 0.28
153 0.3
154 0.24
155 0.28
156 0.36
157 0.38
158 0.45
159 0.47
160 0.45
161 0.48
162 0.52
163 0.51
164 0.49
165 0.47
166 0.41
167 0.48
168 0.47
169 0.41
170 0.38
171 0.35
172 0.3
173 0.27
174 0.25
175 0.18
176 0.17
177 0.16
178 0.14
179 0.13
180 0.13
181 0.16
182 0.16
183 0.16
184 0.16
185 0.16
186 0.18
187 0.17
188 0.18
189 0.13
190 0.13
191 0.16
192 0.16
193 0.16
194 0.14
195 0.18
196 0.16
197 0.21
198 0.25
199 0.23
200 0.24
201 0.24
202 0.29
203 0.27
204 0.26
205 0.22
206 0.18
207 0.17
208 0.16
209 0.15
210 0.09
211 0.07
212 0.06
213 0.05
214 0.05
215 0.06
216 0.07
217 0.08
218 0.1
219 0.1
220 0.1
221 0.12
222 0.12
223 0.12
224 0.13
225 0.14
226 0.13
227 0.15
228 0.15
229 0.13
230 0.13
231 0.12
232 0.11
233 0.12
234 0.15
235 0.16
236 0.16
237 0.17
238 0.16
239 0.15
240 0.16
241 0.13
242 0.1
243 0.12
244 0.12
245 0.18
246 0.18
247 0.18
248 0.18
249 0.18
250 0.23
251 0.21
252 0.21
253 0.18
254 0.21
255 0.21
256 0.22
257 0.24
258 0.18
259 0.17
260 0.17
261 0.15
262 0.15
263 0.16
264 0.17
265 0.17
266 0.17
267 0.21
268 0.25
269 0.27
270 0.27
271 0.29
272 0.32
273 0.33
274 0.33
275 0.34
276 0.29
277 0.26
278 0.23
279 0.21
280 0.17
281 0.13
282 0.14
283 0.08
284 0.09
285 0.08
286 0.09
287 0.09
288 0.08
289 0.08
290 0.09
291 0.09
292 0.12
293 0.16
294 0.15
295 0.2
296 0.21
297 0.21
298 0.27
299 0.36
300 0.42
301 0.47
302 0.53
303 0.57
304 0.59
305 0.66
306 0.63
307 0.65
308 0.65
309 0.66
310 0.68
311 0.63
312 0.61
313 0.54
314 0.51
315 0.46
316 0.37
317 0.31
318 0.25
319 0.24
320 0.22
321 0.23
322 0.22
323 0.19
324 0.18
325 0.15
326 0.14
327 0.15
328 0.15
329 0.12
330 0.13
331 0.15
332 0.15
333 0.17
334 0.2
335 0.26
336 0.26
337 0.26
338 0.25
339 0.28
340 0.28
341 0.25
342 0.22
343 0.15
344 0.14
345 0.14
346 0.13