Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8PYF4

Protein Details
Accession D8PYF4    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
67-86DEPPQPYKRRSVRRGSRAPSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, mito 6
Family & Domain DBs
KEGG scm:SCHCO_01091234  -  
Amino Acid Sequences MVDPLDQRHLLRIPIGGPQLYRTYSGEYRSVAPGQLYYLVSHKPTIRLHIPPFNEDNDDSDSEVDCDEPPQPYKRRSVRRGSRAPSPDVSTEDLDSQPGAGHVLIKGHAELDIVSSYHYNGHHNNTIDGPVDGTEVIHFYRCPGDYGEKGTWVEKNVRWPELVAVSGGRYRTRAIMEQMEARILILYEDSRHENQLVVDSDRKPCFPPCDENDLWARVYLAKLRQPAIARSIEYAWNMIVRKDACGTSRAVAKFATALRAITFGTQGVSASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.24
4 0.22
5 0.24
6 0.27
7 0.26
8 0.27
9 0.23
10 0.27
11 0.28
12 0.31
13 0.31
14 0.29
15 0.3
16 0.32
17 0.31
18 0.26
19 0.23
20 0.2
21 0.18
22 0.2
23 0.18
24 0.15
25 0.17
26 0.18
27 0.18
28 0.21
29 0.22
30 0.24
31 0.25
32 0.31
33 0.34
34 0.38
35 0.43
36 0.47
37 0.48
38 0.46
39 0.47
40 0.43
41 0.41
42 0.34
43 0.31
44 0.28
45 0.27
46 0.22
47 0.2
48 0.18
49 0.16
50 0.15
51 0.13
52 0.08
53 0.09
54 0.1
55 0.11
56 0.14
57 0.22
58 0.27
59 0.3
60 0.4
61 0.49
62 0.58
63 0.63
64 0.71
65 0.74
66 0.78
67 0.84
68 0.79
69 0.78
70 0.72
71 0.68
72 0.6
73 0.53
74 0.45
75 0.38
76 0.36
77 0.28
78 0.24
79 0.22
80 0.19
81 0.16
82 0.13
83 0.11
84 0.08
85 0.07
86 0.07
87 0.05
88 0.05
89 0.05
90 0.06
91 0.07
92 0.07
93 0.07
94 0.06
95 0.06
96 0.06
97 0.05
98 0.06
99 0.06
100 0.05
101 0.06
102 0.06
103 0.06
104 0.08
105 0.09
106 0.11
107 0.12
108 0.16
109 0.2
110 0.21
111 0.21
112 0.19
113 0.2
114 0.17
115 0.15
116 0.11
117 0.07
118 0.07
119 0.06
120 0.05
121 0.04
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.08
128 0.08
129 0.09
130 0.1
131 0.13
132 0.14
133 0.19
134 0.19
135 0.18
136 0.19
137 0.18
138 0.18
139 0.17
140 0.2
141 0.17
142 0.25
143 0.27
144 0.27
145 0.26
146 0.26
147 0.25
148 0.22
149 0.21
150 0.12
151 0.09
152 0.09
153 0.1
154 0.11
155 0.1
156 0.1
157 0.1
158 0.12
159 0.14
160 0.16
161 0.17
162 0.2
163 0.21
164 0.23
165 0.23
166 0.21
167 0.19
168 0.16
169 0.13
170 0.09
171 0.07
172 0.05
173 0.05
174 0.06
175 0.08
176 0.12
177 0.13
178 0.14
179 0.15
180 0.15
181 0.15
182 0.19
183 0.19
184 0.18
185 0.22
186 0.23
187 0.29
188 0.29
189 0.3
190 0.28
191 0.3
192 0.33
193 0.33
194 0.39
195 0.38
196 0.46
197 0.45
198 0.45
199 0.45
200 0.41
201 0.37
202 0.29
203 0.24
204 0.16
205 0.18
206 0.2
207 0.21
208 0.23
209 0.27
210 0.28
211 0.32
212 0.33
213 0.35
214 0.35
215 0.33
216 0.29
217 0.28
218 0.29
219 0.28
220 0.25
221 0.23
222 0.19
223 0.19
224 0.19
225 0.17
226 0.2
227 0.18
228 0.2
229 0.22
230 0.23
231 0.21
232 0.22
233 0.25
234 0.22
235 0.29
236 0.28
237 0.26
238 0.24
239 0.23
240 0.25
241 0.24
242 0.25
243 0.19
244 0.19
245 0.18
246 0.19
247 0.19
248 0.16
249 0.16
250 0.11
251 0.11
252 0.11