Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8PQ89

Protein Details
Accession D8PQ89    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
44-71RRKGRVYVICKKNPRHKQVRHSPSPSVFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG scm:SCHCO_02489554  -  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MKLAPSSVPAHRATAVLTRTPDLTRGMKVRSSVKPMCDGCNVVRRKGRVYVICKKNPRHKQVRHSPSPSVFVFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.23
4 0.23
5 0.22
6 0.23
7 0.23
8 0.23
9 0.21
10 0.2
11 0.21
12 0.22
13 0.24
14 0.24
15 0.26
16 0.31
17 0.3
18 0.36
19 0.35
20 0.33
21 0.37
22 0.37
23 0.36
24 0.31
25 0.3
26 0.25
27 0.31
28 0.31
29 0.28
30 0.31
31 0.3
32 0.31
33 0.34
34 0.38
35 0.38
36 0.45
37 0.51
38 0.56
39 0.64
40 0.69
41 0.72
42 0.76
43 0.79
44 0.81
45 0.81
46 0.81
47 0.84
48 0.87
49 0.89
50 0.88
51 0.84
52 0.82
53 0.75
54 0.71