Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PXP5

Protein Details
Accession D8PXP5   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
54-81DPSVEEHRHHRRRQGIHRRSHHRTPPETBasic
NLS Segment(s)
PositionSequence
64-72RRRQGIHRR
Subcellular Location(s) nucl 12, mito 8, cyto_nucl 8
Family & Domain DBs
KEGG scm:SCHCO_02570336  -  
Amino Acid Sequences MNSYPLPPTLEALNHVSPVRLPNSYGLTLGFASPRHLAEAVDVTPRGERQWWVDPSVEEHRHHRRRQGIHRRSHHRTPPETHHPSQRANLAHANPYAPPTPAPRPVRAPMPAPAPPVVPTQAVTAQAPAPRPQQHVGVRPAPAPQTYFTNAAPVIPPMPVPSVAPVQPEYRATNNCGDHPLPYDPESYTRYFHPSGAPAPRVIPAPAAAPPPPPTQNADSRPSRGRRLSNAFKSLFHKGDCSRASAPAAPPQVVYVPIPAAAAQPAAPQTAPQPAPLNRPAAIDHRAEGTTARSSPAFNIYTCDMLPQIYGAGRDFQRDPHWKGADKKKINVLMPVDLLDCWSIFFNAPNLREIHFWHITGDDSYRVFPQVDVPKLKSLHKGFVALRLTTPGDAQKGSPMTSPPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.25
4 0.23
5 0.27
6 0.27
7 0.22
8 0.22
9 0.24
10 0.29
11 0.29
12 0.28
13 0.23
14 0.22
15 0.21
16 0.21
17 0.18
18 0.13
19 0.16
20 0.17
21 0.17
22 0.18
23 0.18
24 0.17
25 0.17
26 0.21
27 0.19
28 0.21
29 0.2
30 0.19
31 0.2
32 0.21
33 0.2
34 0.19
35 0.19
36 0.21
37 0.31
38 0.33
39 0.34
40 0.36
41 0.34
42 0.37
43 0.45
44 0.44
45 0.37
46 0.43
47 0.51
48 0.58
49 0.63
50 0.65
51 0.64
52 0.69
53 0.78
54 0.81
55 0.8
56 0.81
57 0.86
58 0.88
59 0.87
60 0.87
61 0.84
62 0.82
63 0.8
64 0.77
65 0.76
66 0.77
67 0.77
68 0.71
69 0.72
70 0.68
71 0.65
72 0.61
73 0.58
74 0.49
75 0.45
76 0.47
77 0.4
78 0.39
79 0.36
80 0.33
81 0.27
82 0.28
83 0.25
84 0.2
85 0.19
86 0.2
87 0.25
88 0.33
89 0.36
90 0.37
91 0.42
92 0.44
93 0.48
94 0.45
95 0.43
96 0.37
97 0.39
98 0.37
99 0.34
100 0.32
101 0.27
102 0.26
103 0.25
104 0.23
105 0.18
106 0.16
107 0.16
108 0.17
109 0.17
110 0.15
111 0.15
112 0.15
113 0.17
114 0.18
115 0.19
116 0.23
117 0.25
118 0.29
119 0.29
120 0.34
121 0.37
122 0.43
123 0.45
124 0.43
125 0.41
126 0.38
127 0.38
128 0.33
129 0.28
130 0.23
131 0.18
132 0.19
133 0.2
134 0.21
135 0.19
136 0.2
137 0.19
138 0.18
139 0.17
140 0.13
141 0.11
142 0.09
143 0.09
144 0.08
145 0.09
146 0.09
147 0.08
148 0.1
149 0.11
150 0.12
151 0.14
152 0.14
153 0.14
154 0.15
155 0.17
156 0.17
157 0.19
158 0.2
159 0.21
160 0.26
161 0.26
162 0.25
163 0.26
164 0.24
165 0.21
166 0.23
167 0.21
168 0.17
169 0.17
170 0.17
171 0.14
172 0.17
173 0.2
174 0.18
175 0.18
176 0.17
177 0.21
178 0.21
179 0.21
180 0.2
181 0.18
182 0.21
183 0.24
184 0.24
185 0.19
186 0.19
187 0.19
188 0.19
189 0.17
190 0.13
191 0.09
192 0.09
193 0.1
194 0.11
195 0.1
196 0.11
197 0.14
198 0.16
199 0.18
200 0.18
201 0.19
202 0.21
203 0.28
204 0.31
205 0.34
206 0.33
207 0.36
208 0.41
209 0.42
210 0.44
211 0.43
212 0.42
213 0.43
214 0.5
215 0.55
216 0.54
217 0.58
218 0.53
219 0.5
220 0.5
221 0.48
222 0.41
223 0.33
224 0.31
225 0.25
226 0.32
227 0.3
228 0.31
229 0.27
230 0.26
231 0.27
232 0.26
233 0.27
234 0.25
235 0.26
236 0.21
237 0.2
238 0.19
239 0.18
240 0.16
241 0.14
242 0.09
243 0.08
244 0.08
245 0.08
246 0.08
247 0.07
248 0.06
249 0.06
250 0.06
251 0.07
252 0.07
253 0.08
254 0.07
255 0.07
256 0.09
257 0.15
258 0.16
259 0.16
260 0.22
261 0.23
262 0.29
263 0.32
264 0.34
265 0.28
266 0.29
267 0.29
268 0.27
269 0.29
270 0.24
271 0.21
272 0.21
273 0.2
274 0.19
275 0.18
276 0.16
277 0.16
278 0.15
279 0.16
280 0.14
281 0.14
282 0.15
283 0.21
284 0.19
285 0.16
286 0.19
287 0.19
288 0.2
289 0.19
290 0.18
291 0.13
292 0.11
293 0.11
294 0.08
295 0.08
296 0.08
297 0.09
298 0.09
299 0.14
300 0.14
301 0.18
302 0.18
303 0.2
304 0.28
305 0.35
306 0.39
307 0.43
308 0.48
309 0.5
310 0.59
311 0.67
312 0.69
313 0.66
314 0.67
315 0.66
316 0.68
317 0.64
318 0.61
319 0.53
320 0.46
321 0.4
322 0.36
323 0.29
324 0.22
325 0.21
326 0.15
327 0.11
328 0.09
329 0.09
330 0.09
331 0.09
332 0.1
333 0.15
334 0.2
335 0.22
336 0.24
337 0.25
338 0.26
339 0.27
340 0.29
341 0.31
342 0.28
343 0.27
344 0.25
345 0.24
346 0.24
347 0.24
348 0.23
349 0.18
350 0.16
351 0.18
352 0.18
353 0.19
354 0.18
355 0.16
356 0.23
357 0.28
358 0.35
359 0.39
360 0.41
361 0.46
362 0.49
363 0.52
364 0.53
365 0.49
366 0.49
367 0.47
368 0.5
369 0.44
370 0.5
371 0.51
372 0.42
373 0.39
374 0.35
375 0.34
376 0.28
377 0.29
378 0.25
379 0.24
380 0.24
381 0.23
382 0.26
383 0.27
384 0.28
385 0.29