Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8PL74

Protein Details
Accession D8PL74    Localization Confidence High Confidence Score 22.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-28TYISKWRRPVPDEPPRPRRKLRGSSVGHydrophilic
45-70REEEERRKESRKKRRTRPESNEEQPEBasic
94-114ARTRPRKRSAPENKQRSVKRSBasic
NLS Segment(s)
PositionSequence
15-23PPRPRRKLR
50-61RRKESRKKRRTR
92-139SGARTRPRKRSAPENKQRSVKRSRTAGPQTEPTRRSKRIAEKPSAARS
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences MTYISKWRRPVPDEPPRPRRKLRGSSVGGGLTSEEAAAIFAELDREEEERRKESRKKRRTRPESNEEQPEEDTAAMDLSPDGEDSEVSARGSGARTRPRKRSAPENKQRSVKRSRTAGPQTEPTRRSKRIAEKPSAARS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.83
4 0.85
5 0.84
6 0.83
7 0.83
8 0.82
9 0.8
10 0.8
11 0.76
12 0.72
13 0.68
14 0.58
15 0.48
16 0.38
17 0.29
18 0.19
19 0.13
20 0.09
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.03
27 0.03
28 0.04
29 0.04
30 0.05
31 0.06
32 0.07
33 0.09
34 0.14
35 0.17
36 0.2
37 0.23
38 0.31
39 0.39
40 0.48
41 0.57
42 0.64
43 0.71
44 0.78
45 0.87
46 0.89
47 0.91
48 0.9
49 0.88
50 0.86
51 0.82
52 0.78
53 0.67
54 0.58
55 0.47
56 0.38
57 0.3
58 0.2
59 0.14
60 0.07
61 0.06
62 0.04
63 0.04
64 0.03
65 0.03
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.09
79 0.11
80 0.16
81 0.25
82 0.35
83 0.42
84 0.5
85 0.57
86 0.63
87 0.66
88 0.7
89 0.72
90 0.75
91 0.78
92 0.79
93 0.79
94 0.8
95 0.8
96 0.76
97 0.76
98 0.73
99 0.7
100 0.68
101 0.66
102 0.67
103 0.71
104 0.71
105 0.66
106 0.67
107 0.66
108 0.68
109 0.66
110 0.65
111 0.65
112 0.62
113 0.62
114 0.62
115 0.66
116 0.68
117 0.74
118 0.74
119 0.74