Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PYK8

Protein Details
Accession D8PYK8    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-48AEPAPPVKRGRGRPKGSKNKPKDPNAEPBasic
73-96FSPKPDPLKRKAKQKRKGHHFLGABasic
NLS Segment(s)
PositionSequence
25-60PPVKRGRGRPKGSKNKPKDPNAEPPVKVPKKRGRPA
76-90KPDPLKRKAKQKRKG
Subcellular Location(s) mito 10, nucl 9, cyto 4, extr 2, pero 2
Family & Domain DBs
Amino Acid Sequences MAEKAGEKVAAAATATGDAPAEPAPPVKRGRGRPKGSKNKPKDPNAEPPVKVPKKRGRPAFSSKIMIINLPFFSPKPDPLKRKAKQKRKGHHFLGAYSIAHPAAYDGKDLEVWRCFSKDRGRTGSCLDTAPKKSSIQAAEATAPLAFLIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.07
4 0.07
5 0.06
6 0.07
7 0.07
8 0.08
9 0.07
10 0.11
11 0.13
12 0.18
13 0.21
14 0.28
15 0.35
16 0.45
17 0.55
18 0.62
19 0.68
20 0.74
21 0.82
22 0.86
23 0.89
24 0.9
25 0.88
26 0.88
27 0.89
28 0.87
29 0.83
30 0.78
31 0.78
32 0.74
33 0.72
34 0.62
35 0.58
36 0.6
37 0.59
38 0.56
39 0.54
40 0.56
41 0.6
42 0.67
43 0.71
44 0.66
45 0.67
46 0.73
47 0.72
48 0.66
49 0.59
50 0.51
51 0.45
52 0.39
53 0.32
54 0.24
55 0.18
56 0.14
57 0.11
58 0.11
59 0.08
60 0.12
61 0.12
62 0.16
63 0.22
64 0.29
65 0.33
66 0.41
67 0.52
68 0.53
69 0.64
70 0.7
71 0.73
72 0.76
73 0.82
74 0.84
75 0.84
76 0.88
77 0.8
78 0.78
79 0.69
80 0.59
81 0.53
82 0.44
83 0.34
84 0.26
85 0.22
86 0.15
87 0.13
88 0.11
89 0.08
90 0.1
91 0.1
92 0.1
93 0.09
94 0.1
95 0.12
96 0.13
97 0.15
98 0.14
99 0.16
100 0.17
101 0.19
102 0.19
103 0.24
104 0.33
105 0.37
106 0.42
107 0.48
108 0.49
109 0.5
110 0.55
111 0.53
112 0.45
113 0.41
114 0.37
115 0.36
116 0.38
117 0.39
118 0.37
119 0.33
120 0.34
121 0.38
122 0.37
123 0.33
124 0.31
125 0.3
126 0.29
127 0.28
128 0.26
129 0.19
130 0.17