FuNGI

D8PW80

Protein Details

Accession

D8PW80

Localization Confidence

High

Confidence Score

15.9

NoLS Segment(s)

Position	Sequence	Protein Nature
334-369	QPQDGTVQKPKPRRHRPRLSMPKRKKKAEPVPAPIP	Basic
450-474	RISPNNSQAPKPRPPPRQRNRKRRR	Basic

NLS Segment(s)

Position	Sequence
342-362	KPKPRRHRPRLSMPKRKKKAE
459-474	PKPRPPPRQRNRKRRR

Subcellular Location(s)

nucl 12.5, mito 11, cyto_nucl 8.5

Family & Domain DBs

InterPro	View protein in InterPro IPR028651 ING_fam IPR024610 ING_N_histone-binding IPR019786 Zinc_finger_PHD-type_CS IPR011011 Znf_FYVE_PHD IPR001965 Znf_PHD IPR019787 Znf_PHD-finger IPR013083 Znf_RING/FYVE/PHD
Gene Ontology	GO:0000785 C:chromatin GO:0005634 C:nucleus GO:0046872 F:metal ion binding GO:0006325 P:chromatin organization
KEGG	scm:SCHCO_02606858 -
Pfam	View protein in Pfam PF12998 ING PF00628 PHD
PROSITE	View protein in PROSITE PS01359 ZF_PHD_1 PS50016 ZF_PHD_2
CDD	cd16859 ING_ING4_5 cd15505 PHD_ING

Amino Acid Sequences

MTRRKSLRGAAAPASESEAGEPMEEDTVNGDEVQGEETPELTTGSGEATTPREGSPMNVDGQSPDEERAEREQQLWEAFRDEYFETIEQMPLHLQRQFTLMKELEQQAHSYEEDLLPTLRKYIARRHELAGVPSPSPVPVEMATNSPPSAIPSRLSEQPSQLLRRSISRPPLTNGVSTSSIPITPLRRPTLEGLSTPRTPTPFGIPPERTKPPQTTRQMLSHLAWLSEEIVHASEEKVHIAQAAYDSVVRHIRLIDQAIKEQEESITLGVRPGTRLAPVLLPDAPQLVRPTFRESMSPGVVQDPLAQDLELDGAEPAENEQEQDTEADAEGSAQPQDGTVQKPKPRRHRPRLSMPKRKKKAEPVPAPIPVEEPATVTAPKTTSRPKKLTLLPASTELVDEPVYCVCRGISAGTMVACDSPDCSKEWFHLACVGLAEQPAEEEPWYCPACRISPNNSQAPKPRPPPRQRNRKRRR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.43
2	0.33
3	0.26
4	0.21
5	0.18
6	0.15
7	0.14
8	0.13
9	0.1
10	0.11
11	0.11
12	0.1
13	0.1
14	0.11
15	0.11
16	0.1
17	0.09
18	0.08
19	0.09
20	0.11
21	0.09
22	0.09
23	0.09
24	0.09
25	0.1
26	0.1
27	0.1
28	0.08
29	0.07
30	0.07
31	0.08
32	0.07
33	0.07
34	0.09
35	0.11
36	0.13
37	0.14
38	0.14
39	0.15
40	0.15
41	0.17
42	0.21
43	0.21
44	0.22
45	0.21
46	0.22
47	0.21
48	0.23
49	0.24
50	0.19
51	0.18
52	0.18
53	0.18
54	0.21
55	0.26
56	0.28
57	0.27
58	0.27
59	0.28
60	0.29
61	0.33
62	0.32
63	0.27
64	0.24
65	0.23
66	0.21
67	0.22
68	0.19
69	0.16
70	0.17
71	0.16
72	0.16
73	0.17
74	0.19
75	0.15
76	0.16
77	0.17
78	0.17
79	0.19
80	0.19
81	0.18
82	0.17
83	0.21
84	0.22
85	0.21
86	0.25
87	0.23
88	0.22
89	0.27
90	0.3
91	0.3
92	0.29
93	0.28
94	0.22
95	0.24
96	0.22
97	0.18
98	0.16
99	0.13
100	0.12
101	0.12
102	0.12
103	0.11
104	0.11
105	0.12
106	0.13
107	0.16
108	0.19
109	0.27
110	0.36
111	0.41
112	0.44
113	0.45
114	0.49
115	0.48
116	0.48
117	0.45
118	0.38
119	0.32
120	0.29
121	0.27
122	0.2
123	0.19
124	0.16
125	0.11
126	0.09
127	0.11
128	0.11
129	0.14
130	0.15
131	0.16
132	0.15
133	0.14
134	0.13
135	0.14
136	0.16
137	0.15
138	0.15
139	0.18
140	0.21
141	0.26
142	0.3
143	0.28
144	0.27
145	0.32
146	0.35
147	0.35
148	0.34
149	0.32
150	0.29
151	0.33
152	0.35
153	0.35
154	0.39
155	0.4
156	0.4
157	0.4
158	0.46
159	0.42
160	0.39
161	0.34
162	0.28
163	0.26
164	0.23
165	0.21
166	0.15
167	0.14
168	0.13
169	0.15
170	0.15
171	0.17
172	0.22
173	0.23
174	0.24
175	0.26
176	0.28
177	0.31
178	0.29
179	0.27
180	0.27
181	0.29
182	0.29
183	0.28
184	0.26
185	0.22
186	0.21
187	0.21
188	0.21
189	0.22
190	0.24
191	0.3
192	0.32
193	0.34
194	0.39
195	0.42
196	0.4
197	0.38
198	0.43
199	0.42
200	0.48
201	0.5
202	0.49
203	0.49
204	0.5
205	0.49
206	0.44
207	0.38
208	0.33
209	0.28
210	0.22
211	0.18
212	0.15
213	0.12
214	0.1
215	0.09
216	0.05
217	0.05
218	0.05
219	0.06
220	0.05
221	0.06
222	0.06
223	0.06
224	0.06
225	0.06
226	0.06
227	0.06
228	0.06
229	0.06
230	0.06
231	0.05
232	0.06
233	0.06
234	0.08
235	0.1
236	0.09
237	0.09
238	0.09
239	0.1
240	0.11
241	0.13
242	0.16
243	0.15
244	0.18
245	0.18
246	0.19
247	0.17
248	0.16
249	0.14
250	0.1
251	0.09
252	0.07
253	0.07
254	0.07
255	0.07
256	0.08
257	0.08
258	0.08
259	0.09
260	0.09
261	0.09
262	0.1
263	0.1
264	0.1
265	0.11
266	0.12
267	0.11
268	0.11
269	0.11
270	0.12
271	0.11
272	0.11
273	0.12
274	0.11
275	0.13
276	0.14
277	0.2
278	0.21
279	0.21
280	0.22
281	0.22
282	0.25
283	0.25
284	0.24
285	0.18
286	0.17
287	0.17
288	0.15
289	0.15
290	0.12
291	0.11
292	0.11
293	0.1
294	0.09
295	0.08
296	0.09
297	0.06
298	0.05
299	0.04
300	0.04
301	0.04
302	0.04
303	0.04
304	0.05
305	0.05
306	0.06
307	0.06
308	0.06
309	0.07
310	0.07
311	0.07
312	0.07
313	0.07
314	0.07
315	0.06
316	0.07
317	0.07
318	0.07
319	0.06
320	0.06
321	0.06
322	0.06
323	0.08
324	0.09
325	0.13
326	0.2
327	0.27
328	0.33
329	0.42
330	0.51
331	0.61
332	0.7
333	0.77
334	0.81
335	0.85
336	0.88
337	0.91
338	0.93
339	0.93
340	0.93
341	0.93
342	0.93
343	0.91
344	0.9
345	0.86
346	0.86
347	0.86
348	0.85
349	0.84
350	0.81
351	0.78
352	0.76
353	0.69
354	0.58
355	0.49
356	0.39
357	0.31
358	0.23
359	0.18
360	0.14
361	0.15
362	0.15
363	0.13
364	0.14
365	0.14
366	0.15
367	0.19
368	0.28
369	0.36
370	0.45
371	0.5
372	0.53
373	0.6
374	0.66
375	0.71
376	0.69
377	0.64
378	0.57
379	0.55
380	0.52
381	0.44
382	0.37
383	0.26
384	0.2
385	0.15
386	0.12
387	0.1
388	0.11
389	0.13
390	0.12
391	0.12
392	0.11
393	0.12
394	0.12
395	0.13
396	0.12
397	0.11
398	0.13
399	0.12
400	0.13
401	0.12
402	0.11
403	0.1
404	0.09
405	0.09
406	0.1
407	0.11
408	0.13
409	0.15
410	0.16
411	0.19
412	0.26
413	0.25
414	0.24
415	0.28
416	0.27
417	0.26
418	0.26
419	0.24
420	0.18
421	0.17
422	0.16
423	0.1
424	0.11
425	0.1
426	0.1
427	0.1
428	0.1
429	0.11
430	0.18
431	0.19
432	0.19
433	0.21
434	0.23
435	0.28
436	0.35
437	0.4
438	0.4
439	0.49
440	0.56
441	0.63
442	0.63
443	0.64
444	0.65
445	0.67
446	0.69
447	0.69
448	0.72
449	0.74
450	0.81
451	0.86
452	0.88
453	0.92
454	0.93

D8PW80

3D AlphaFold-predicted Structure Viewer