Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8Q4D8

Protein Details
Accession D8Q4D8    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-70HEPPPPPARQPRRPRIQPMTTHydrophilic
NLS Segment(s)
PositionSequence
34-36KKP
58-58R
61-61R
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021711  DUF3295  
KEGG scm:SCHCO_01095374  -  
Pfam View protein in Pfam  
PF11702  DUF3295  
Amino Acid Sequences MESDTGEEEDGGDRVELSQSVAQQRLAALVGKGKKPAHRSSAEAGTSHAHEPPPPPARQPRRPRIQPMTTVNHSRAPSPTRTNTEARPTSTVDPSPAAPIPLGYPYNLPPPPEPSSPRTTRQLMLRTEMSESVRQNLLWSRQLARRDNMGPPRTRSGILEQPPARPTIAAQPSVVRLTAPRQQDPAEQQQEQEDIRREMRLARNRTWAGDEFHQTGWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.08
4 0.1
5 0.12
6 0.15
7 0.2
8 0.22
9 0.21
10 0.21
11 0.21
12 0.19
13 0.18
14 0.15
15 0.12
16 0.16
17 0.21
18 0.23
19 0.28
20 0.31
21 0.36
22 0.42
23 0.48
24 0.49
25 0.48
26 0.5
27 0.5
28 0.55
29 0.5
30 0.43
31 0.38
32 0.32
33 0.3
34 0.27
35 0.23
36 0.16
37 0.16
38 0.18
39 0.25
40 0.29
41 0.28
42 0.33
43 0.42
44 0.51
45 0.59
46 0.68
47 0.69
48 0.74
49 0.8
50 0.84
51 0.82
52 0.79
53 0.76
54 0.73
55 0.7
56 0.64
57 0.61
58 0.53
59 0.5
60 0.44
61 0.37
62 0.34
63 0.3
64 0.31
65 0.34
66 0.37
67 0.36
68 0.4
69 0.42
70 0.41
71 0.46
72 0.43
73 0.39
74 0.37
75 0.34
76 0.32
77 0.32
78 0.29
79 0.21
80 0.2
81 0.18
82 0.17
83 0.15
84 0.12
85 0.1
86 0.09
87 0.09
88 0.1
89 0.1
90 0.08
91 0.09
92 0.1
93 0.16
94 0.17
95 0.17
96 0.16
97 0.21
98 0.24
99 0.26
100 0.28
101 0.27
102 0.33
103 0.36
104 0.38
105 0.38
106 0.37
107 0.37
108 0.39
109 0.41
110 0.36
111 0.36
112 0.34
113 0.29
114 0.28
115 0.27
116 0.23
117 0.21
118 0.2
119 0.18
120 0.18
121 0.17
122 0.17
123 0.19
124 0.2
125 0.2
126 0.21
127 0.23
128 0.26
129 0.33
130 0.36
131 0.35
132 0.36
133 0.35
134 0.41
135 0.46
136 0.47
137 0.45
138 0.45
139 0.48
140 0.45
141 0.43
142 0.38
143 0.35
144 0.37
145 0.37
146 0.41
147 0.38
148 0.4
149 0.4
150 0.39
151 0.33
152 0.25
153 0.22
154 0.23
155 0.26
156 0.24
157 0.24
158 0.24
159 0.26
160 0.27
161 0.26
162 0.16
163 0.14
164 0.17
165 0.22
166 0.26
167 0.26
168 0.28
169 0.3
170 0.35
171 0.4
172 0.46
173 0.47
174 0.42
175 0.41
176 0.4
177 0.42
178 0.37
179 0.36
180 0.31
181 0.28
182 0.29
183 0.3
184 0.28
185 0.33
186 0.41
187 0.45
188 0.47
189 0.48
190 0.56
191 0.57
192 0.59
193 0.56
194 0.5
195 0.46
196 0.46
197 0.46
198 0.39