Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8Q2A3

Protein Details
Accession D8Q2A3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
134-159ASGSGKHRASKQRRHHRRLSRSHPYSBasic
NLS Segment(s)
PositionSequence
139-154KHRASKQRRHHRRLSR
Subcellular Location(s) nucl 13.5, cyto_nucl 13, cyto 11.5
Family & Domain DBs
Amino Acid Sequences MNPATSSQELDTLIPCFGETEGTYDGAVRDTGSLYVLVEEDLLPLDLISLDRMRRPSHRARQIDLEIEQETPVMGLGLLGVEERHTLDPLPCDPVMSLTSTMATVTIESRGQVDWGAPFIFSVSHTFSADAATASGSGKHRASKQRRHHRRLSRSHPYSPERPLAKPLLTNLPPIEGLLAGEDDLAAAPLSPLVLPATWPSPIGSCRSSARPGSASRSTSIARSRYSSSSPARSVLAHAPMVLPEEPCQASWAVPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.1
5 0.11
6 0.1
7 0.12
8 0.14
9 0.14
10 0.14
11 0.14
12 0.14
13 0.13
14 0.13
15 0.09
16 0.08
17 0.08
18 0.09
19 0.09
20 0.09
21 0.08
22 0.08
23 0.08
24 0.07
25 0.07
26 0.07
27 0.06
28 0.06
29 0.06
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.07
36 0.09
37 0.1
38 0.14
39 0.17
40 0.2
41 0.25
42 0.32
43 0.41
44 0.49
45 0.58
46 0.59
47 0.6
48 0.65
49 0.64
50 0.6
51 0.5
52 0.43
53 0.33
54 0.29
55 0.25
56 0.17
57 0.13
58 0.09
59 0.08
60 0.05
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.04
70 0.05
71 0.06
72 0.07
73 0.07
74 0.09
75 0.11
76 0.12
77 0.16
78 0.14
79 0.14
80 0.13
81 0.15
82 0.14
83 0.13
84 0.13
85 0.09
86 0.09
87 0.09
88 0.09
89 0.07
90 0.06
91 0.05
92 0.05
93 0.06
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.06
102 0.07
103 0.07
104 0.06
105 0.05
106 0.05
107 0.05
108 0.06
109 0.07
110 0.08
111 0.09
112 0.1
113 0.1
114 0.1
115 0.1
116 0.1
117 0.08
118 0.06
119 0.05
120 0.05
121 0.05
122 0.07
123 0.08
124 0.1
125 0.11
126 0.14
127 0.2
128 0.3
129 0.39
130 0.47
131 0.57
132 0.66
133 0.76
134 0.81
135 0.85
136 0.85
137 0.87
138 0.87
139 0.86
140 0.85
141 0.8
142 0.78
143 0.76
144 0.71
145 0.66
146 0.6
147 0.58
148 0.5
149 0.45
150 0.43
151 0.39
152 0.35
153 0.31
154 0.29
155 0.3
156 0.28
157 0.29
158 0.25
159 0.23
160 0.21
161 0.2
162 0.18
163 0.09
164 0.08
165 0.06
166 0.06
167 0.05
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.04
180 0.04
181 0.05
182 0.05
183 0.07
184 0.09
185 0.09
186 0.1
187 0.1
188 0.12
189 0.14
190 0.18
191 0.17
192 0.18
193 0.21
194 0.26
195 0.3
196 0.29
197 0.32
198 0.32
199 0.34
200 0.39
201 0.41
202 0.39
203 0.35
204 0.37
205 0.34
206 0.35
207 0.38
208 0.35
209 0.31
210 0.33
211 0.36
212 0.36
213 0.39
214 0.42
215 0.42
216 0.45
217 0.45
218 0.43
219 0.4
220 0.37
221 0.37
222 0.35
223 0.33
224 0.26
225 0.24
226 0.23
227 0.22
228 0.25
229 0.22
230 0.17
231 0.14
232 0.19
233 0.19
234 0.19
235 0.2
236 0.17