Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8Q9D8

Protein Details
Accession D8Q9D8    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
32-54LKTDTKIQYNAKRRHWRRTKLNIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12.666, mito 10.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG scm:SCHCO_02631909  -  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences PSPQPSQKTFRTKRILAKASRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.69
4 0.72
5 0.72
6 0.72
7 0.73
8 0.68
9 0.63
10 0.6
11 0.62
12 0.62
13 0.56
14 0.53
15 0.55
16 0.54
17 0.53
18 0.53
19 0.5
20 0.44
21 0.49
22 0.52
23 0.46
24 0.51
25 0.54
26 0.58
27 0.64
28 0.7
29 0.71
30 0.74
31 0.77
32 0.81
33 0.84
34 0.85