Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PSK9

Protein Details
Accession D8PSK9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
22-49SVKFLKKIIRQPRPAHPKQRKRTYGMPSHydrophilic
NLS Segment(s)
PositionSequence
28-42KIIRQPRPAHPKQRK
Subcellular Location(s) plas 10, extr 8, mito 5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036938  P_Acid_Pase_2/haloperoxi_sf  
IPR000326  P_Acid_Pase_2/haloperoxidase  
Gene Ontology GO:0016020  C:membrane  
GO:0006629  P:lipid metabolic process  
KEGG scm:SCHCO_02605740  -  
Pfam View protein in Pfam  
PF01569  PAP2  
Amino Acid Sequences ILYTRSAGVTYVPVCGLACSISVKFLKKIIRQPRPAHPKQRKRTYGMPSTHSAVVAYFSTYVLLASARLPIHPSLPLNPLITRTIPALIIVPWATLVACSRVWLRKHSWIQVVAGCAYGTLFASIAFSVWTRGELSQYNDWIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.08
5 0.08
6 0.09
7 0.1
8 0.14
9 0.16
10 0.19
11 0.2
12 0.25
13 0.32
14 0.35
15 0.45
16 0.52
17 0.59
18 0.65
19 0.69
20 0.75
21 0.78
22 0.8
23 0.82
24 0.82
25 0.83
26 0.84
27 0.89
28 0.85
29 0.81
30 0.81
31 0.78
32 0.76
33 0.7
34 0.63
35 0.55
36 0.52
37 0.46
38 0.37
39 0.29
40 0.19
41 0.16
42 0.12
43 0.1
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.05
50 0.04
51 0.04
52 0.04
53 0.07
54 0.07
55 0.07
56 0.08
57 0.09
58 0.09
59 0.1
60 0.11
61 0.11
62 0.13
63 0.15
64 0.14
65 0.14
66 0.15
67 0.15
68 0.15
69 0.14
70 0.12
71 0.11
72 0.1
73 0.1
74 0.09
75 0.07
76 0.08
77 0.07
78 0.06
79 0.06
80 0.06
81 0.05
82 0.05
83 0.06
84 0.07
85 0.07
86 0.08
87 0.11
88 0.17
89 0.19
90 0.23
91 0.28
92 0.35
93 0.41
94 0.45
95 0.48
96 0.43
97 0.44
98 0.42
99 0.39
100 0.3
101 0.25
102 0.19
103 0.13
104 0.11
105 0.09
106 0.07
107 0.06
108 0.05
109 0.05
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.08
116 0.08
117 0.1
118 0.11
119 0.11
120 0.15
121 0.18
122 0.23
123 0.27