Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PQ80

Protein Details
Accession D8PQ80    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
85-104DSRPKKFEPRHRKNSSAPKSBasic
NLS Segment(s)
PositionSequence
88-104PKKFEPRHRKNSSAPKS
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
KEGG scm:SCHCO_02160300  -  
Amino Acid Sequences MSYPTNIGPAPWQQYTPYQGNSYQVPPYAQPQNNPPPFIPRAYPQRTAGAGGATNGYYSYGQGQATPNYGHHVPIQDSLNPPDLDSRPKKFEPRHRKNSSAPKSAMKRSATATAAIPVPDAGKEPFPSFAHAGGHTPQEGANGNLHRHHSTPEGTTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.37
4 0.34
5 0.32
6 0.32
7 0.34
8 0.35
9 0.33
10 0.29
11 0.25
12 0.24
13 0.22
14 0.26
15 0.33
16 0.32
17 0.31
18 0.38
19 0.47
20 0.49
21 0.5
22 0.45
23 0.42
24 0.43
25 0.42
26 0.36
27 0.32
28 0.38
29 0.41
30 0.45
31 0.4
32 0.42
33 0.4
34 0.39
35 0.33
36 0.25
37 0.19
38 0.15
39 0.14
40 0.1
41 0.09
42 0.07
43 0.07
44 0.06
45 0.06
46 0.07
47 0.08
48 0.08
49 0.1
50 0.11
51 0.11
52 0.13
53 0.13
54 0.12
55 0.14
56 0.14
57 0.13
58 0.13
59 0.14
60 0.13
61 0.15
62 0.16
63 0.15
64 0.16
65 0.17
66 0.2
67 0.18
68 0.17
69 0.17
70 0.17
71 0.22
72 0.26
73 0.28
74 0.3
75 0.32
76 0.4
77 0.44
78 0.54
79 0.59
80 0.65
81 0.72
82 0.73
83 0.76
84 0.77
85 0.81
86 0.78
87 0.75
88 0.67
89 0.64
90 0.63
91 0.63
92 0.61
93 0.51
94 0.45
95 0.4
96 0.42
97 0.35
98 0.31
99 0.26
100 0.21
101 0.21
102 0.18
103 0.16
104 0.11
105 0.1
106 0.09
107 0.1
108 0.09
109 0.11
110 0.13
111 0.14
112 0.18
113 0.19
114 0.22
115 0.22
116 0.23
117 0.23
118 0.22
119 0.23
120 0.21
121 0.22
122 0.18
123 0.17
124 0.16
125 0.16
126 0.16
127 0.15
128 0.2
129 0.21
130 0.23
131 0.27
132 0.31
133 0.31
134 0.31
135 0.32
136 0.31
137 0.31